TkA08G064020 | RubberDandelionOmics

Gene overview

TkA08G064020

Reference: TK1151 Chr: Chr08 Coordinates: 16369901-16373047 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2300 bp · TkA08G064020|TK1151|cDNA

CTGGATTCCTTTCATTTGGGTGGGTTTGTGTGTCCCCCACTGAGATCGATACAGTTCTCTCTCCGTTACCACAGCAGCAGCAACAAACGGATCATCCAAACTGCCTTCAATATCATCAATCGCCTCAACCTCATCTTCGGTGTCGTAGAAGGGTTCCGTATCATAGACGGAACTGGCATCACCAAATGGATCAGTATCGTCTTCCTCCTCCTCGTCCCAGACGATTGGATCGGAATCAGACAAAATACGGGAGTATACCT...

CDS

Download CDS FASTA

441 bp · TkA08G064020|TK1151|CDS

ATGGGTAAATTGGATGAAGCACTATCTGTCTGCATCAATGCTAAAGAGCTTTTATACAAGAATGATTTAATATTGATTGATGATCTCACATTAAGCACATTGCAGATTGTTTTTCAACGGCTAGATCATTTGGACATGGCTACCAGTTGTTATGAGTATGCATGTGGAAAATTTTCAAACAATTTGGAACTGATGATGGGACTCTTCAATTGCTATGTCCGTGAATATTCTTTTGTGAAACAGCAACAGATAGCCATTAA...

Protein

Download Protein FASTA

146 aa · TkA08G064020|TK1151|PROTEIN

MGKLDEALSVCINAKELLYKNDLILIDDLTLSTLQIVFQRLDHLDMATSCYEYACGKFSNNLELMMGLFNCYVREYSFVKQQQIAIKMYKIAGEERFLLWAVCSIKMYKSGSRSKRKRRRKRHPPPTPPTIRKRMVRIRTENEINV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G064020`
TK1151 ID	TkA08G064020
OH-1004 ID	LXL04_035750
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 68.868 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G064020

Location Chr08:16369901-16373047 (+)

Description Similar to NAA25: N-terminal acetyltransferase B complex auxiliary subunit NAA25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58450`	Auxiliary subunit of the NatB N-alpha-acetyltransferase complex.	Mutation of an Arabidopsis NatB N-alpha-terminal acetylation complex component causes pleiotropic developmental defects.2013 · DOI: 10.1371/journal.pone.0080697

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035750 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002253 activation of immune response Biological Process

GO:0006911 phagocytosis, engulfment Biological Process

GO:0006955 immune response Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0010592 positive regulation of lamellipodium assembly Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0045087 innate immune response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G58450

dme:Dmel_CG4845

hsa:80018

mmu:231713

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.493

Rank 1 · TkA08G064020 · TK1151

Cytoplasm0.389

Rank 2 · TkA08G064020 · TK1151

Mitochondrion0.074

Rank 3 · TkA08G064020 · TK1151

Cell membrane0.055

Rank 4 · TkA08G064020 · TK1151

Endoplasmic reticulum0.044

Rank 5 · TkA08G064020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31234TPR_Psidin_N1-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G064020	`PF31234`	TPR_Psidin_N	1	117	7.4e-33	114.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KEY9`	Arabidopsis thaliana	sp\|F4KEY9\|NAA25_ARATH N-terminal acetyltransferase B complex auxiliary subunit NAA25	80.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card