TkA08G064010 | RubberDandelionOmics

Gene overview

TkA08G064010

Reference: TK1151 Chr: Chr08 Coordinates: 16365620-16370266 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2866 bp · TkA08G064010|TK1151|cDNA

TTTTATGGTTGTTCGTTACCAGTTGCCAGTTTATGATTTTTTATTTAAATCAAATATAAAATGAAGCAACTTCATAAAATGAAGAAAAGAACAACACCTTCCGAAAGGAATCTTAAACATACAAAGCATACATCAGAAACGGCCAAGTCAAAATTAAGCAACTTCATAAACAAAGCACACATGCATGATGCAACAGCATTTCATTTCCATTTCCATTTCCATTTCCCCTTTCTAGAATCCTCAAAATCCAAATCAATTCC...

CDS

Download CDS FASTA

2103 bp · TkA08G064010|TK1151|CDS

ATGGCGACTGTATCATCTTTGACCAGGTCCAAGGGTGTGAGAAGAACAGGGGGAAGAACCAAATCCCCATTCGAGTCGCCTTCATCCGATTCATACATGAATTCGAGTGCCAAAAAAGGGAGTAATCAGGGAGATAGTGATTCCGATTTCACTGGATTCACTTCATCCATGCATGATTCTACCTCCAGTGCAACATCTTCGATTGATCGATACAGTAATGGCAAGGAATCACGATTCCAACGAAAGAAACCACTGGAAAA...

Protein

Download Protein FASTA

700 aa · TkA08G064010|TK1151|PROTEIN

MATVSSLTRSKGVRRTGGRTKSPFESPSSDSYMNSSAKKGSNQGDSDSDFTGFTSSMHDSTSSATSSIDRYSNGKESRFQRKKPLEKSNSKKRWSFRLSKRNPPWVSLPDDGSATKHHASPVEVSDEPPARKPVLKVTRSGSLRSLKILRSKSKSSSTADNLHSNKATFSSILKDSKFPEQVEPPVGVKESEVNFPVGKLCPYQHCSLHGHHHHNEPPVKRFSFLKRRSSKDQKGVNPKTPATVDKPSNNKTEAKVTKKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G064010`
TK1151 ID	TkA08G064010
OH-1004 ID	LXL04_018490
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G064010

Location Chr08:16365620-16370266 (-)

Description Similar to PICBP: Calmodulin binding protein PICBP

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04020`	Binds calmodulin in a calcium-dependent manner in vitro.	Characterization of a pathogen-induced calmodulin-binding protein: mapping of four Ca2+-dependent calmodulin-binding domains.2003 · DOI: 10.1023/a:1023993713849

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018490 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005516 calmodulin binding Molecular Function

KEGG gene cross-reference

ath:AT5G04020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.448

Rank 1 · TkA08G064010 · TK1151

Cytoplasm0.356

Rank 2 · TkA08G064010 · TK1151

Nucleus0.316

Rank 3 · TkA08G064010 · TK1151

Endoplasmic reticulum0.054

Rank 4 · TkA08G064010 · TK1151

Mitochondrion0.037

Rank 5 · TkA08G064010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07839CaM_binding70-93 aa

PF07839CaM_binding141-160 aa

PF07839CaM_binding219-266 aa

PF07839CaM_binding340-374 aa

PF07839CaM_binding396-495 aa

PF24499Ig_TMEM131L_4443-486 aa

PF17363DUF5388460-493 aa

PF07839CaM_binding514-547 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G064010	`PF07839`	CaM_binding	70	93	1.5e-45	155.4
TkA08G064010	`PF07839`	CaM_binding	141	160	1.5e-45	155.4
TkA08G064010	`PF07839`	CaM_binding	219	266	1.5e-45	155.4
TkA08G064010	`PF07839`	CaM_binding	340	374	1.5e-45	155.4
TkA08G064010	`PF07839`	CaM_binding	396	495	1.5e-45	155.4
TkA08G064010	`PF24499`	Ig_TMEM131L_4	443	486	0.84	10.7
TkA08G064010	`PF17363`	DUF5388	460	493	0.03	15.1
TkA08G064010	`PF07839`	CaM_binding	514	547	1.5e-45	155.4
TkA08G064010	`PF07839`	CaM_binding	623	696	1.5e-45	155.4
TkA08G064010	`PF24499`	Ig_TMEM131L_4	624	686	0.84	10.7
TkA08G064010	`PF17363`	DUF5388	664	692	0.03	15.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`A0A1P8BH59`	Arabidopsis thaliana	sp\|A0A1P8BH59\|PICBP_ARATH Calmodulin binding protein PICBP	25.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card