TkA08G060370 | RubberDandelionOmics

Gene overview

TkA08G060370

Reference: TK1151 Chr: Chr08 Coordinates: 15465547-15469483 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · TkA08G060370|TK1151|cDNA

CCGTTCTTCATCGCAATCACCGTATATCTTGGAAGATGTTTTAGGGGCCAGGGTTTGCTGCGATTGGGTGTTCCAAAGCTGCAGAGATGTTCATATTATCAAAACTCAGTTGCAGTTTGGGTTGCCGATACTTTGCTTATTGAACAACATGGAGATAGTATCTTAAAAGACAGAGTAGTGAGTCCAAGAATATCCACCATTTCTTCAGATGATGACACAAAAGATATAAAAAATATATATGTGGACAATGAAGCTTTTCA...

CDS

Download CDS FASTA

672 bp · TkA08G060370|TK1151|CDS

CCGTTCTTCATCGCAATCACCGTATATCTTGGAAGATGTTTTAGGGGCCAGGGTTTGCTGCGATTGGGTGTTCCAAAGCTGCAGAGATGTTCATATTATCAAAACTCAGTTGCAGTTTGGGTTGCCGATACTTTGCTTATTGAACAACATGGAGATAGTATCTTAAAAGACAGAGTAGTGAGTCCAAGAATATCCACCATTTCTTCAGATGATGACACAAAAGATATAAAAAATATATATGTGGACAATGAAGCTTTTCA...

Protein

Download Protein FASTA

223 aa · TkA08G060370|TK1151|PROTEIN

PFFIAITVYLGRCFRGQGLLRLGVPKLQRCSYYQNSVAVWVADTLLIEQHGDSILKDRVVSPRISTISSDDDTKDIKNIYVDNEAFQVGDEVEIVGSEGMHKFSLYRAQIVGMHGELVEVEYYNRLTFGGERLSEFVLPTKVRSIPDAVVGDFKPTDFVDAWLEGGWWGGIVLGGNEQSAIVFFPYKPTGNQHLILPKSQLRIHQKWTRAQQYEMWLYRKRFT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G060370`
TK1151 ID	TkA08G060370
OH-1004 ID	LXL04_011372
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	62.800
Protein coverage (%)	TK1151 100.000 / OH-1004 78.360 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G060370

Location Chr08:15465547-15469483 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61210`	May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity).	DWA3, an Arabidopsis DWD protein, acts as a negative regulator in ABA signal transduction.2011 · DOI: 10.1016/j.plantsci.2010.10.008

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011372 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006346 DNA methylation-dependent constitutive heterochromatin formation Biological Process

GO:0007019 microtubule depolymerization Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0051013 microtubule severing Biological Process

GO:0051510 regulation of unidimensional cell growth Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000792 heterochromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005874 microtubule Cellular Component

GO:0008352 katanin complex Cellular Component

KEGG gene cross-reference

ath:AT1G09320

ath:AT1G61210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.522

Rank 1 · TkA08G060370 · TK1151

Cytoplasm0.421

Rank 2 · TkA08G060370 · TK1151

Endoplasmic reticulum0.076

Rank 3 · TkA08G060370 · TK1151

Cell membrane0.069

Rank 4 · TkA08G060370 · TK1151

Mitochondrion0.047

Rank 5 · TkA08G060370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05641Agenet89-146 aa

PF05641Agenet164-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G060370	`PF05641`	Agenet	89	146	3.5e-05	24.9
TkA08G060370	`PF05641`	Agenet	164	204	3.5e-05	24.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HTH8`	Arabidopsis thaliana	sp\|F4HTH8\|KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2	39.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card