TkA08G058990 | RubberDandelionOmics

Gene overview

TkA08G058990

Reference: TK1151 Chr: Chr08 Coordinates: 15099268-15100751 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

847 bp · TkA08G058990|TK1151|cDNA

TTGTGGGGTAGAATCATGAGCGAGCGATCTGAGTGACGACGGCAGATTATAAACTCTCTACTTTACCGAAACACCCTTCACTCTAAACCTTCGATCTCCCAACATCGCCACTCAAATTCAACAAGGCGGTTTCCCTACGGTGCTCCCCGCCGTCCCGCTCATCGATTCAGCCTCTGCTGTGTTAATGGCATGGGAAATAATCTGGTGGGTCCTCTTCTTCATTATGAACATAGCCCTCATCGCTGCTAATCTATATCAGA...

CDS

Download CDS FASTA

453 bp · TkA08G058990|TK1151|CDS

ATGGCATGGGAAATAATCTGGTGGGTCCTCTTCTTCATTATGAACATAGCCCTCATCGCTGCTAATCTATATCAGATTGTGTGCCTAACGGATTTGGAAGCTGACTACATGAACCCGTATGACTCATCATCTCGCATTAATGCTGTGATAATTCCAGAGATGGTAATCCATGGTGTATGTTGTGCTCTTTTTCTTTTAACAGGGCACTGGTTAATGTTCCTGCTTACACTCCCCCTCACTATATATAATGCCATGCTATA...

Protein

Download Protein FASTA

150 aa · TkA08G058990|TK1151|PROTEIN

MAWEIIWWVLFFIMNIALIAANLYQIVCLTDLEADYMNPYDSSSRINAVIIPEMVIHGVCCALFLLTGHWLMFLLTLPLTIYNAMLYSKRRHLIDVTEVFRFIGAEKKLRIVRLAFYLFLFVLVVIRMVIAIVNNLIDDEEEGVHGFGMF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G058990`
TK1151 ID	TkA08G058990
OH-1004 ID	LXL04_018414
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G058990

Location Chr08:15099268-15100751 (+)

Description Similar to At3g12180: Protein cornichon homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12180`	Protein cornichon homolog 1.	No verified direct reference in this release
`At1g12390`	Protein cornichon homolog 4.	No verified direct reference in this release
`At1g12340`	Probable protein cornichon homolog 2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0506400`	Acts as a cargo receptor necessary for the transportation of secretory proteins from the endoplasmic reticulum (ER) in COPII-coated vesicles targeted to the Golgi apparatus.	No verified direct reference in this release
`Os06g0136500`	May act as a cargo receptor in vesicular transport of HKT1;3 and other proteins from the endoplasmic reticulum to the Golgi apparatus.	Identification of rice cornichon as a possible cargo receptor for the Golgi-localized sodium transporter OsHKT1;3.2015 · DOI: 10.1093/jxb/erv069

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018414 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016192 vesicle-mediated transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0005102 signaling receptor binding Molecular Function

GO:0038024 cargo receptor activity Molecular Function

KEGG gene cross-reference

ath:AT1G12340

ath:AT1G12390

ath:AT3G12180

dosa:Os06g0136500

dosa:Os12g0506400

osa:4352293

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.442

Rank 1 · TkA08G058990 · TK1151

Golgi apparatus0.350

Rank 2 · TkA08G058990 · TK1151

Cytoplasm0.220

Rank 3 · TkA08G058990 · TK1151

Cell membrane0.151

Rank 4 · TkA08G058990 · TK1151

Lysosome / Vacuole0.071

Rank 5 · TkA08G058990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03311Cornichon6-124 aa

PF10754DUF25698-133 aa

PF03579SHP9-26 aa

PF16781DUF506819-56 aa

PF03579SHP70-83 aa

PF03579SHP119-139 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G058990	`PF03311`	Cornichon	6	124	4.5e-42	143.9
TkA08G058990	`PF10754`	DUF2569	8	133	8.5	7.5
TkA08G058990	`PF03579`	SHP	9	26	3.2	8.2
TkA08G058990	`PF16781`	DUF5068	19	56	0.39	11.5
TkA08G058990	`PF03579`	SHP	70	83	3.2	8.2
TkA08G058990	`PF03579`	SHP	119	139	3.2	8.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7D7`	Arabidopsis thaliana	sp\|Q9C7D7\|CNIH1_ARATH Protein cornichon homolog 1	52.500%	Swiss-Prot	High
`Q84W04`	Arabidopsis thaliana	sp\|Q84W04\|CNIH4_ARATH Protein cornichon homolog 4	49.300%	Swiss-Prot	Medium
`Q3EDD7`	Arabidopsis thaliana	sp\|Q3EDD7\|CNIH2_ARATH Probable protein cornichon homolog 2	48.400%	Swiss-Prot	Medium
`Q2QQ55`	Oryza sativa subsp. japonica	sp\|Q2QQ55\|CNIH2_ORYSJ Protein cornichon homolog 2	47.900%	Swiss-Prot	Medium
`Q0DET3`	Oryza sativa subsp. japonica	sp\|Q0DET3\|CNIH1_ORYSJ Protein cornichon homolog 1	53.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card