RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G058810
Reference: TK1151 Chr: Chr08 Coordinates: 15044103-15046319 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2157 bp · TkA08G058810|TK1151|cDNA

ATGTACTATCTCTATGTTCGTGTTGAAAAAGCGAGAGACCTACCTATAAATCCTTTAACTGCTAGCTGTGATCCCTACGTTGAAGTCAAACTCGGGAACTACAAAGGGAAAACAAAGCATTTTGAGAAGAGAACTTACGCGGAATGGAAACAGGTGTTTGCGTTTTCAAAAGAGAAGATACAGTCGACTGTTCTCGAAGTTTATGTGAAGGATAAAGATATGATTTCGAGAGATGATTATTTGGGGAAGGTGGTGTTTGA...

CDS

Download CDS FASTA

2157 bp · TkA08G058810|TK1151|CDS

ATGTACTATCTCTATGTTCGTGTTGAAAAAGCGAGAGACCTACCTATAAATCCTTTAACTGCTAGCTGTGATCCCTACGTTGAAGTCAAACTCGGGAACTACAAAGGGAAAACAAAGCATTTTGAGAAGAGAACTTACGCGGAATGGAAACAGGTGTTTGCGTTTTCAAAAGAGAAGATACAGTCGACTGTTCTCGAAGTTTATGTGAAGGATAAAGATATGATTTCGAGAGATGATTATTTGGGGAAGGTGGTGTTTGA...

Protein

Download Protein FASTA

718 aa · TkA08G058810|TK1151|PROTEIN

MYYLYVRVEKARDLPINPLTASCDPYVEVKLGNYKGKTKHFEKRTYAEWKQVFAFSKEKIQSTVLEVYVKDKDMISRDDYLGKVVFDMNEVPTRVPPDSPLAPQWYRLEDRKGERKIKGEVMLAVWMGTQADEAFSEAWHSDAATVHGEGVFSVRSKVVNVIEAQDVESADKSQLPQVFVKAQLGNQILKTKLSATKTTNPLWNEDLVFVAAEPFEEQLVLTLENKATSKEEIVGRIVLPLNSFEKRLDHRTVHSKWYNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G058810
TK1151 IDTkA08G058810
OH-1004 IDLXL04_018403
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)97.200
Protein coverage (%)TK1151 100.000 / OH-1004 93.418
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G058810
LocationChr08:15044103-15046319 (-)
DescriptionSimilar to FTIP1: FT-interacting protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g06850 Involved in the export of FT from the phloem companion cells to the sieve elements through the plasmodesmata.
FTIP1 is an essential regulator required for florigen transport.2012 · DOI: 10.1371/journal.pbio.1001313
Characterization of Multiple C2 Domain and Transmembrane Region Proteins in Arabidopsis.2018 · DOI: 10.1104/pp.17.01144
At5g48060 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release
At5g12970 May function as a signaling molecule by regulating the trafficking of other regulators. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0614000 Involved in the export of the long day-specific flower- promoting signal (florigen) RFT1 from the phloem companion cells to sieve elements.
OsFTIP1-Mediated Regulation of Florigen Transport in Rice Is Negatively Regulated by the Ubiquitin-Like Domain Kinase OsUbDKγ4.2017 · DOI: 10.1105/tpc.16.00728
Os05g0370600 Promotes nuclear translocation of the transcription factor OSH1, which directly suppresses the auxin biosynthetic gene YUCCA4 during the late development of anthers.
OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018403 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009663 plasmodesma organization Biological Process
GO:0009901 anther dehiscence Biological Process
GO:0009908 flower development Biological Process
GO:0009911 positive regulation of flower development Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process
GO:0048574 long-day photoperiodism, flowering Biological Process
GO:0048578 positive regulation of long-day photoperiodism, flowering Biological Process
GO:1902182 shoot apical meristem development Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference
ath:AT3G57880
ath:AT5G06850
ath:AT5G48060
dosa:Os05g0370600
dosa:Os06g0614000
osa:4338582
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.491
Rank 1 · TkA08G058810 · TK1151
Cell membrane0.251
Rank 2 · TkA08G058810 · TK1151
Golgi apparatus0.190
Rank 3 · TkA08G058810 · TK1151
Cytoplasm0.176
Rank 4 · TkA08G058810 · TK1151
Nucleus0.082
Rank 5 · TkA08G058810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C23-108 aa
PF00168C2158-260 aa
PF19706DUF6203299-313 aa
PF00168C2308-418 aa
PF24677DUF7657506-584 aa
PF06398Pex24p519-699 aa
PF04842DUF639529-562 aa
PF08372PRT_C536-555 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G058810PF00168C231087.2e-62206.8
TkA08G058810PF00168C21582607.2e-62206.8
TkA08G058810PF19706DUF62032993130.1612.6
TkA08G058810PF00168C23084187.2e-62206.8
TkA08G058810PF24677DUF76575065842.17.7
TkA08G058810PF06398Pex24p5196990.0004520.1
TkA08G058810PF04842DUF6395295620.839.8
TkA08G058810PF08372PRT_C5365551.3e-79266.2
TkA08G058810PF08372PRT_C5637181.3e-79266.2
TkA08G058810PF04842DUF6396476900.839.8
TkA08G058810PF24677DUF76576586892.17.7
TkA08G058810PF19706DUF62036646980.1612.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FL59Arabidopsis thalianasp|Q9FL59|FTIP1_ARATH FT-interacting protein 175.900%Swiss-ProtHigh
Q9FI32Arabidopsis thalianasp|Q9FI32|MCTP2_ARATH Multiple C2 domain and transmembrane region protein 268.400%Swiss-ProtHigh
Q9LXU2Arabidopsis thalianasp|Q9LXU2|MCTP5_ARATH Multiple C2 domain and transmembrane region protein 567.000%Swiss-ProtHigh
Q69T22Oryza sativa subsp. japonicasp|Q69T22|FTIP1_ORYSJ FT-interacting protein 168.200%Swiss-ProtHigh
Q60EW9Oryza sativa subsp. japonicasp|Q60EW9|FTIP7_ORYSJ FT-interacting protein 767.100%Swiss-ProtHigh

JBrowse

View in Genome Browser