TkA08G058790 | RubberDandelionOmics

Gene overview

TkA08G058790

Reference: TK1151 Chr: Chr08 Coordinates: 15032559-15036035 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3025 bp · TkA08G058790|TK1151|cDNA

ATAACATTAGGGGTGTCACTGCAATTTACCCAAAGTTAAATTGTTGTTGCACTCTTCCTTAAAGAGACAGCAAGACACACAGACATACTCACATACCATCCACCATCTCCTCCTCCTCCGCTTTTCTCTCTCTCTAAACCCCTCTTTCTCTCTCTAAACCCCTGTTGCCATCGCATTTTTTATCGTCTCAAATCGTCTATAACTCTATATTCTCATGAATCTGATTCCAGAAGATTAAAAAAGCAACTCCATTAATTTCT...

CDS

Download CDS FASTA

2328 bp · TkA08G058790|TK1151|CDS

ATGATGCACAGACCTCCTCCCCACGATGATTTCTCACTCAAGGAGACCAAACCCCACCTCGGTGGCGGCAAGGTCACCGGAGATAAGCTCACAAGCACATACGACCTCGTGGAACAAATGCAATACCTCTACGTCCGTGTAGTAAAAGCACGAGAGTTACCTGCAAAAGACCTCACCGGAAGCTGCGACCCTTACGCTGAAGTCCGAATAGGAAACTACAAGGGCACAACCCGTCATTTTGAGAAAAAATCAAACCCCGA...

Protein

Download Protein FASTA

775 aa · TkA08G058790|TK1151|PROTEIN

MMHRPPPHDDFSLKETKPHLGGGKVTGDKLTSTYDLVEQMQYLYVRVVKARELPAKDLTGSCDPYAEVRIGNYKGTTRHFEKKSNPEWNQVFAFSRDRIQATTLEVSVKDKDFAKDDFMGWVLFDLSEVPKRVPPDSPLAPQWYRLEDRKGSKLKGELMLAVWWGTQADEAFPEAWHSDAATVGGSDALSNIRSKVYLSPKLWYLRVNVIEAQDLIPSDRTRFPEVFVKAALGHQALRTRISLNKSINPMWNEDLMFVAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G058790`
TK1151 ID	TkA08G058790
OH-1004 ID	LXL04_018402
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 84.222 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G058790

Location Chr08:15032559-15036035 (+)

Description Similar to FTIP3: FT-interacting protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57880`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
`At1g51570`	Required for proliferation and differentiation of shoot stem cells in the shoot apical meristem (SAM), thus determining the appropriate balance between the maintenance of shoot stem cells and their differentiation into other aboveground plant parts via the control of subcellular localization and intercellular trafficking of STM in the shoot apex.	FTIP-Dependent STM Trafficking Regulates Shoot Meristem Development in Arabidopsis.2018 · DOI: 10.1016/j.celrep.2018.04.033
`At5g12970`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release
`At4g11610`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0370600`	Promotes nuclear translocation of the transcription factor OSH1, which directly suppresses the auxin biosynthetic gene YUCCA4 during the late development of anthers.	OsFTIP7 determines auxin-mediated anther dehiscence in rice.2018 · DOI: 10.1038/s41477-018-0175-0

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018402 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009663 plasmodesma organization Biological Process

GO:0009901 anther dehiscence Biological Process

GO:0010930 negative regulation of auxin mediated signaling pathway Biological Process

GO:1902182 shoot apical meristem development Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G51570

ath:AT3G57880

ath:AT4G11610

ath:AT5G12970

dosa:Os05g0370600

osa:4338582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.374

Rank 1 · TkA08G058790 · TK1151

Cell membrane0.344

Rank 2 · TkA08G058790 · TK1151

Cytoplasm0.260

Rank 3 · TkA08G058790 · TK1151

Golgi apparatus0.193

Rank 4 · TkA08G058790 · TK1151

Nucleus0.091

Rank 5 · TkA08G058790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C242-145 aa

PF00168C2203-309 aa

PF00168C2365-475 aa

PF06398Pex24p511-563 aa

PF08372PRT_C574-609 aa

PF11696DUF3292577-630 aa

PF04842DUF639583-624 aa

PF02453Reticulon592-631 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G058790	`PF00168`	C2	42	145	1.2e-69	231.9
TkA08G058790	`PF00168`	C2	203	309	1.2e-69	231.9
TkA08G058790	`PF00168`	C2	365	475	1.2e-69	231.9
TkA08G058790	`PF06398`	Pex24p	511	563	6.6e-05	22.8
TkA08G058790	`PF08372`	PRT_C	574	609	3.6e-83	277.7
TkA08G058790	`PF11696`	DUF3292	577	630	2.4	7.2
TkA08G058790	`PF04842`	DUF639	583	624	0.19	11.9
TkA08G058790	`PF02453`	Reticulon	592	631	1.8	9.2
TkA08G058790	`PF06398`	Pex24p	593	754	6.6e-05	22.8
TkA08G058790	`PF08372`	PRT_C	620	775	3.6e-83	277.7
TkA08G058790	`PF05545`	FixQ	622	644	0.12	13.0
TkA08G058790	`PF11696`	DUF3292	681	742	2.4	7.2
TkA08G058790	`PF04842`	DUF639	704	739	0.19	11.9
TkA08G058790	`PF02453`	Reticulon	706	742	1.8	9.2
TkA08G058790	`PF05545`	FixQ	718	731	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2R0`	Arabidopsis thaliana	sp\|Q9M2R0\|FTIP3_ARATH FT-interacting protein 3	86.800%	Swiss-Prot	High
`Q9C8H3`	Arabidopsis thaliana	sp\|Q9C8H3\|FTIP4_ARATH FT-interacting protein 4	84.900%	Swiss-Prot	High
`Q9LXU2`	Arabidopsis thaliana	sp\|Q9LXU2\|MCTP5_ARATH Multiple C2 domain and transmembrane region protein 5	79.100%	Swiss-Prot	High
`Q84TJ7`	Arabidopsis thaliana	sp\|Q84TJ7\|MCTP7_ARATH Multiple C2 domain and transmembrane region protein 7	67.900%	Swiss-Prot	High
`Q60EW9`	Oryza sativa subsp. japonica	sp\|Q60EW9\|FTIP7_ORYSJ FT-interacting protein 7	81.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card