TkA08G058580 | RubberDandelionOmics

Gene overview

TkA08G058580

Reference: TK1151 Chr: Chr08 Coordinates: 14978082-14979399 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

931 bp · TkA08G058580|TK1151|cDNA

ATTCAAACCGGAGTCCCTGGTCCAGTTCAAATCATAGGAAAGAAAGGCGACGAGACGATAATCAAAGATTTATCAAAGAAAAAATGGTATTACAAATTCGGATTGGATGGATTCGACCACAAATTCTTTTCTGGAAATACCTCCCACTGGCGAGTTCATGATCTTCCTATTTCTCGAAGAATGACTTGGTACAAGACAACATTCAAAGCTCCATTAGGAAACGAACCTGTGTCATTGGATTTGGAAGGATTAGGTAAAGG...

CDS

Download CDS FASTA

801 bp · TkA08G058580|TK1151|CDS

ATTCAAACCGGAGTCCCTGGTCCAGTTCAAATCATAGGAAAGAAAGGCGACGAGACGATAATCAAAGATTTATCAAAGAAAAAATGGTATTACAAATTCGGATTGGATGGATTCGACCACAAATTCTTTTCTGGAAATACCTCCCACTGGCGAGTTCATGATCTTCCTATTTCTCGAAGAATGACTTGGTACAAGACAACATTCAAAGCTCCATTAGGAAACGAACCTGTGTCATTGGATTTGGAAGGATTAGGTAAAGG...

Protein

Download Protein FASTA

266 aa · TkA08G058580|TK1151|PROTEIN

IQTGVPGPVQIIGKKGDETIIKDLSKKKWYYKFGLDGFDHKFFSGNTSHWRVHDLPISRRMTWYKTTFKAPLGNEPVSLDLEGLGKGVVWVNGNNIGRYWPSYIAQETGCSNEACDYRGPYTNTKCVTNCGKPTQKWYHVPRSFLVNGENELVLFEEYGGNPLSVNFQMVRVGTTCGNAYENKTMEISCQNRRISSIRFASFGDVKGSCGSFSRGSCHEESDVETVIQKACIGKETCTIEAIEGVLGSTNCGYGVGKRLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G058580`
TK1151 ID	TkA08G058580
OH-1004 ID	LXL04_002293
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.300
Protein coverage (%)	TK1151 99.624 / OH-1004 31.976 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G058580

Location Chr08:14978082-14979399 (+)

Description Similar to Beta-galactosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20710`	Beta-galactosidase 7.	No verified direct reference in this release
`At1g31740`	Beta-galactosidase 15.	No verified direct reference in this release
`At2g28470`	Beta-galactosidase 8.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0340600`	Beta-galactosidase 14.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002293 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT1G31740

ath:AT2G28470

ath:AT5G20710

dosa:Os03g0255100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.916

Rank 1 · TkA08G058580 · TK1151

Cytoplasm0.045

Rank 2 · TkA08G058580 · TK1151

Cell membrane0.028

Rank 3 · TkA08G058580 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA08G058580 · TK1151

Lysosome / Vacuole0.016

Rank 5 · TkA08G058580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13364BetaGal_ABD260-122 aa

PF21467BetaGal_gal-bd61-150 aa

PF02140SUEL_Lectin114-127 aa

PF02140SUEL_Lectin187-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G058580	`PF13364`	BetaGal_ABD2	60	122	0.0073	17.7
TkA08G058580	`PF21467`	BetaGal_gal-bd	61	150	3.7e-26	91.8
TkA08G058580	`PF02140`	SUEL_Lectin	114	127	9.4e-13	49.1
TkA08G058580	`PF02140`	SUEL_Lectin	187	265	9.4e-13	49.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCV5`	Arabidopsis thaliana	sp\|Q9SCV5\|BGAL7_ARATH Beta-galactosidase 7	52.600%	Swiss-Prot	High
`Q9C6W4`	Arabidopsis thaliana	sp\|Q9C6W4\|BGA15_ARATH Beta-galactosidase 15	46.000%	Swiss-Prot	Medium
`Q9SCV4`	Arabidopsis thaliana	sp\|Q9SCV4\|BGAL8_ARATH Beta-galactosidase 8	42.800%	Swiss-Prot	Medium
`Q7XFK2`	Oryza sativa subsp. japonica	sp\|Q7XFK2\|BGA14_ORYSJ Beta-galactosidase 14	45.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card