TkA08G058220 | RubberDandelionOmics

Gene overview

TkA08G058220

Reference: TK1151 Chr: Chr08 Coordinates: 14880841-14882348 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

978 bp · TkA08G058220|TK1151|cDNA

TCAAAGTAGTTAAGAATTCAACTTCTTTGATAATAATACTACCTGTTTAAGTGATAAATCCATCTTCTATACGCCTCTAGGCTCCAGCCCTCCATCTCCATTGACTTTCCCCTGTTCAACGATAATCAATAATCCATCTCCATCGACTCCAGAACACTCTGTTCATCAATTCGTCCATTTTCTCAAGCATCGGCGAGGCGAGGGGAGGCCACAGAGTAGACGGCGTCGGAGGGGAACAAAAGAAAACAATTCCGGCTAGG...

CDS

Download CDS FASTA

534 bp · TkA08G058220|TK1151|CDS

ATGGCTGTTGTGCTAATGGGTGCGAGTGGTGTCGGGAAATCAACTATCGGGGAAATGCTTGCGAACACTCTAAATTGCATCTTCATTGATGCCGATGATTTCCATCCACATTCAAACAAAGAGAAGATGAAGAACGGGGTCCCTTTATCAGATGAAGACCGTACCCCATGGCTTGAAGTGCTTCGGGATTTACTTAATGCAAGTTTAGTGAGTGGCAATACTGTAATTCTTGGGTGTTCTGCCCTTCAGAAGAAATATAG...

Protein

Download Protein FASTA

177 aa · TkA08G058220|TK1151|PROTEIN

MAVVLMGASGVGKSTIGEMLANTLNCIFIDADDFHPHSNKEKMKNGVPLSDEDRTPWLEVLRDLLNASLVSGNTVILGCSALQKKYRDILRFADPNFKGDSCEKCVVKFVLLDVGVEVLMDRVAKRAAEGKHFMPAELLQSQMELLEVDVSEGILKVDASRSPQDIVDEIKALTFSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G058220`
TK1151 ID	TkA08G058220
OH-1004 ID	LXL04_018390
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G058220

Location Chr08:14880841-14882348 (+)

Description Similar to At2g16790: Gluconokinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16790`	Phosphorylates gluconate to 6-phosphogluconate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018390 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0019521 D-gluconate metabolic process Biological Process

GO:0046183 L-idonate catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

GO:0046316 gluconokinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G16790

ecj:JW4225

eco:b4268

ecoc:C3026_23020

hsa:414328

mmu:75731

rno:498695

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.674

Rank 1 · TkA08G058220 · TK1151

Nucleus0.355

Rank 2 · TkA08G058220 · TK1151

Mitochondrion0.105

Rank 3 · TkA08G058220 · TK1151

Peroxisome0.076

Rank 4 · TkA08G058220 · TK1151

Cell membrane0.048

Rank 5 · TkA08G058220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06414Zeta_toxin2-39 aa

PF01583APS_kinase2-64 aa

PF13173AAA_142-40 aa

PF01121CoaE2-33 aa

PF07475Hpr_kinase_C2-21 aa

PF13191AAA_162-25 aa

PF05272VapE-like_dom2-44 aa

PF13671AAA_333-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G058220	`PF06414`	Zeta_toxin	2	39	0.0016	18.6
TkA08G058220	`PF01583`	APS_kinase	2	64	0.007	17.1
TkA08G058220	`PF13173`	AAA_14	2	40	0.013	16.2
TkA08G058220	`PF01121`	CoaE	2	33	0.015	15.7
TkA08G058220	`PF07475`	Hpr_kinase_C	2	21	0.038	14.3
TkA08G058220	`PF13191`	AAA_16	2	25	0.038	15.2
TkA08G058220	`PF05272`	VapE-like_dom	2	44	0.12	12.6
TkA08G058220	`PF13671`	AAA_33	3	145	5.2e-10	40.5
TkA08G058220	`PF13238`	AAA_18	3	129	1.5e-07	32.6
TkA08G058220	`PF13401`	AAA_22	3	32	0.0014	19.7
TkA08G058220	`PF20720`	nSTAND3	3	24	0.0041	17.5
TkA08G058220	`PF03193`	RsgA_GTPase	3	23	0.0067	17.0
TkA08G058220	`PF00005`	ABC_tran	3	36	0.0073	17.6
TkA08G058220	`PF05729`	NACHT	3	24	0.014	15.9
TkA08G058220	`PF00004`	AAA	3	34	0.025	15.7
TkA08G058220	`PF13521`	AAA_28	3	25	0.041	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLE0`	Arabidopsis thaliana	sp\|Q9SLE0\|GNTK_ARATH Gluconokinase	52.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card