TkA08G057740 | RubberDandelionOmics

Gene overview

TkA08G057740

Reference: TK1151 Chr: Chr08 Coordinates: 14757575-14765878 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1102 bp · TkA08G057740|TK1151|cDNA

CATGATTGACGATACTCTGTTTCTCTTTCTGCGCATCACGACTAACATTACACAGAGATTAACGTTCTCCGGAACCAAATTCCATCTTTCAAAATGTCGGTTATTGCATACAAAGAGATCTTCAATTCATCGTCATCATCAACCGGAAGTGAAAGACCTTACAGCTTCACCGCGTTGCTAATTCATGGCTTACTGGGTTGCGGAGATGACTTTGCAGATTTCGCTAACTCACTCGTTGTTTCTCTCTCTACTGATTGGAG...

CDS

Download CDS FASTA

978 bp · TkA08G057740|TK1151|CDS

ATGTCGGCAATTGGATTCAAAGAAATCTTCAGTTCATCATCATCATCCAGTAAAAGTGAAATACCCTACAGTTTCACCGCCTTCCTAATTCATGGCTTACTTGGTTGTGGAGAAGACTTTGTAGATTTCGCTAACTCCCTCGTCTCGTCTCTCTCTACTGAATGGAGGATGGTTCTTGTGGATTTGAGGAGCCATGGAAGCTCAGTTGATCGAGAAGGTTTATCCCCACCTCATGACATTTCAAATGCTGCTAGAGATCT...

Protein

Download Protein FASTA

325 aa · TkA08G057740|TK1151|PROTEIN

MSAIGFKEIFSSSSSSSKSEIPYSFTAFLIHGLLGCGEDFVDFANSLVSSLSTEWRMVLVDLRSHGSSVDREGLSPPHDISNAARDLANLVKSLNWAWPDVVIGHSMGGKVALQYALSCAHGDYGDSAQVPKQVWVLDSVPGKVANKSQYQELMKMLHTLQTIPTTIPSQEWLVNYMIDYGFSKFLSEWISSTLKKSGEHMTFSFDVDGAIQMFESARDGDYWLLLEEPPKGMEIDIVRTESQLTWDLDVVERLESLTSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G057740`
TK1151 ID	TkA08G057740
OH-1004 ID	LXL04_018367
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	86.000
Protein coverage (%)	TK1151 85.846 / OH-1004 91.475 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G057740`
Location	Chr08:14757575-14765878 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018367` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0015979 photosynthesis Biological Process GO:0036070 light-independent bacteriochlorophyll biosynthetic process Biological Process GO:0046464 acylglycerol catabolic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0016020 membrane Cellular Component GO:0045252 oxoglutarate dehydrogenase complex Cellular Component GO:0005524 ATP binding Molecular Function GO:0016298 lipase activity Molecular Function GO:0016851 magnesium chelatase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	dre:446169 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.544

Rank 1 · TkA08G057740 · TK1151

Nucleus0.291

Rank 2 · TkA08G057740 · TK1151

Peroxisome0.124

Rank 3 · TkA08G057740 · TK1151

Plastid0.094

Rank 4 · TkA08G057740 · TK1151

Mitochondrion0.091

Rank 5 · TkA08G057740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29892McsA24-51 aa

PF12697Abhydrolase_628-282 aa

PF00975Thioesterase28-170 aa

PF12146Hydrolase_428-120 aa

PF00561Abhydrolase_129-117 aa

PF20408Abhydrolase_1169-116 aa

PF05705DUF82979-178 aa

PF11187Mbeg1-like84-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G057740	`PF29892`	McsA	24	51	0.15	12.7
TkA08G057740	`PF12697`	Abhydrolase_6	28	282	1.8e-12	49.1
TkA08G057740	`PF00975`	Thioesterase	28	170	1e-07	33.1
TkA08G057740	`PF12146`	Hydrolase_4	28	120	1.1e-06	28.9
TkA08G057740	`PF00561`	Abhydrolase_1	29	117	1.4e-10	42.0
TkA08G057740	`PF20408`	Abhydrolase_11	69	116	0.045	14.2
TkA08G057740	`PF05705`	DUF829	79	178	0.15	12.6
TkA08G057740	`PF11187`	Mbeg1-like	84	160	0.013	15.6
TkA08G057740	`PF00756`	Esterase	100	118	0.035	14.6
TkA08G057740	`PF07819`	PGAP1	101	114	0.016	15.7
TkA08G057740	`PF03816`	LytR_cpsA_psr	105	167	0.16	12.2
TkA08G057740	`PF00561`	Abhydrolase_1	149	187	1.4e-10	42.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card