TkA08G057660 | RubberDandelionOmics

Gene overview

TkA08G057660

Reference: TK1151 Chr: Chr08 Coordinates: 14735204-14735686 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · TkA08G057660|TK1151|cDNA

ATGGAAGCGGTTTTCAATCGATATCTTCCATTCAAACAACGTCTCTACACATCGACGCCGCCGTCGCATAATCACCACGGTGTTCCAAATCTCCGACATGGCCGTCGATCGGCCATGAGTATCCCGAGTCTTCTACGAATCACAACCGCTCTTAATCGATCTCATCGCAATCCAATTCAATTTTTGGTCAGAAGCACAAGTTATCTAGATCTCAGTTTCGATTTTAATTTCAACATCACCATGGATGATTCTCATACTAA...

CDS

Download CDS FASTA

483 bp · TkA08G057660|TK1151|CDS

ATGGAAGCGGTTTTCAATCGATATCTTCCATTCAAACAACGTCTCTACACATCGACGCCGCCGTCGCATAATCACCACGGTGTTCCAAATCTCCGACATGGCCGTCGATCGGCCATGAGTATCCCGAGTCTTCTACGAATCACAACCGCTCTTAATCGATCTCATCGCAATCCAATTCAATTTTTGGTCAGAAGCACAAGTTATCTAGATCTCAGTTTCGATTTTAATTTCAACATCACCATGGATGATTCTCATACTAA...

Protein

Download Protein FASTA

160 aa · TkA08G057660|TK1151|PROTEIN

MEAVFNRYLPFKQRLYTSTPPSHNHHGVPNLRHGRRSAMSIPSLLRITTALNRSHRNPIQFLVRSTSYLDLSFDFNFNITMDDSHTKKEFKSADGLTPVNDTKETKKTLEIPPPPEKPLPGDCCGSGCVRCVWDIYYDELEEYNKLLKGETDSTIGSKVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G057660`
TK1151 ID	TkA08G057660
OH-1004 ID	LXL04_018369
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 93.023 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G057660`
Location	Chr08:14735204-14735686 (+)
Description	Similar to SPCP31B10.02: UPF0651 protein P31B10.02, mitochondrial (Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018369` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005739 mitochondrion Cellular Component GO:0016491 oxidoreductase activity Molecular Function
KEGG gene cross-reference	spo:2539599 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.783

Rank 1 · TkA08G057660 · TK1151

Nucleus0.094

Rank 2 · TkA08G057660 · TK1151

Plastid0.090

Rank 3 · TkA08G057660 · TK1151

Cytoplasm0.078

Rank 4 · TkA08G057660 · TK1151

Cell membrane0.016

Rank 5 · TkA08G057660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20725DUF683215-89 aa

PF09791Oxidored-like110-147 aa

PF17653DUF5522121-134 aa

PF14775NYD-SP28_assoc132-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G057660	`PF20725`	DUF6832	15	89	0.16	12.4
TkA08G057660	`PF09791`	Oxidored-like	110	147	5.8e-16	58.7
TkA08G057660	`PF17653`	DUF5522	121	134	0.12	13.2
TkA08G057660	`PF14775`	NYD-SP28_assoc	132	148	0.099	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card