TkA08G054000 | RubberDandelionOmics

Gene overview

TkA08G054000

Reference: TK1151 Chr: Chr08 Coordinates: 13832141-13833233 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

873 bp · TkA08G054000|TK1151|cDNA

ATGGCGGAGCTCGATCCCATAACGACGGATGTGTCATCTGACGTACCTTTGTTCCACATCCTACCAAGGCTGCCGGTGAAGTCTCTCTTCCGCTTTACATGTGTTTCCAAGAAATGGAACTCCTTTCTAAAGACGCCTGTGTTTTGCAAGATGCACCGACATCGTGTAATCTGCAACGATCATCAATTTCACCAGAAGATTCTCTTCCTACCTGACGCACAACCGTGGGAGTTCCGCACCATCAATTGTGAAACACCAAA...

CDS

Download CDS FASTA

873 bp · TkA08G054000|TK1151|CDS

ATGGCGGAGCTCGATCCCATAACGACGGATGTGTCATCTGACGTACCTTTGTTCCACATCCTACCAAGGCTGCCGGTGAAGTCTCTCTTCCGCTTTACATGTGTTTCCAAGAAATGGAACTCCTTTCTAAAGACGCCTGTGTTTTGCAAGATGCACCGACATCGTGTAATCTGCAACGATCATCAATTTCACCAGAAGATTCTCTTCCTACCTGACGCACAACCGTGGGAGTTCCGCACCATCAATTGTGAAACACCAAA...

Protein

Download Protein FASTA

290 aa · TkA08G054000|TK1151|PROTEIN

MAELDPITTDVSSDVPLFHILPRLPVKSLFRFTCVSKKWNSFLKTPVFCKMHRHRVICNDHQFHQKILFLPDAQPWEFRTINCETPKDGFTASRPLPFKVGADKKVSVMTSLHGMVCVGVTKPGTFDDYSDLILWNPVTGDYKTLSKVGSHNDCYTVDEDQFGFFYNSSEDDYKLVCVTGRIIRKREHSLCVAFINSLGRYETIELWRQDGSSGEWNKVVTKEKEHWYHDDQLLHVMRNGNRLMHPTWEDYVYELDPNKH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G054000`
TK1151 ID	TkA08G054000
OH-1004 ID	LXL04_017724
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	77.700
Protein coverage (%)	TK1151 97.241 / OH-1004 91.826 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G054000

Location Chr08:13832141-13833233 (-)

Description Similar to At1g53370: Putative F-box protein At1g53370

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53370`	Putative F-box protein At1g53370.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017724 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0052542 defense response by callose deposition Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G53370

ath:AT3G06240

ath:AT3G16210

ath:AT5G07610

ath:AT5G15660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.661

Rank 1 · TkA08G054000 · TK1151

Nucleus0.399

Rank 2 · TkA08G054000 · TK1151

Cell membrane0.078

Rank 3 · TkA08G054000 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA08G054000 · TK1151

Extracellular0.046

Rank 5 · TkA08G054000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box15-49 aa

PF12937F-box-like17-46 aa

PF12937F-box-like53-67 aa

PF08268FBA_3103-183 aa

PF07734FBA_1126-241 aa

PF08268FBA_3193-229 aa

PF12937F-box-like216-229 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G054000	`PF00646`	F-box	15	49	5.6e-06	26.8
TkA08G054000	`PF12937`	F-box-like	17	46	0.00025	21.4
TkA08G054000	`PF12937`	F-box-like	53	67	0.00025	21.4
TkA08G054000	`PF08268`	FBA_3	103	183	1.6e-05	24.8
TkA08G054000	`PF07734`	FBA_1	126	241	0.00065	19.5
TkA08G054000	`PF08268`	FBA_3	193	229	1.6e-05	24.8
TkA08G054000	`PF12937`	F-box-like	216	229	0.00025	21.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAG5`	Arabidopsis thaliana	sp\|Q9MAG5\|FB56_ARATH Putative F-box protein At1g53370	28.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card