TkA08G053750 | RubberDandelionOmics

Gene overview

TkA08G053750

Reference: TK1151 Chr: Chr08 Coordinates: 13743966-13748668 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2099 bp · TkA08G053750|TK1151|cDNA

CTCATTTTGTTTTCAGTTCTTCTCCTATCTTTACTTGCATCTTTTGTTTCAGGTCAAGTGTTTTGGAGTGTAAACTGTGGGGAATCAGAGATCTACACTGATAGTAACCTAATGATTTGGACGCCGGACGCAACTCTAATCTCCAATGGGGTTGCTCGAGTGGTTCAGTCAAGTAATAAAATATCTACAGTGCTAGACTCTCTTAGAGTTTTCACTAGTCGAAAAAAGAATTGCTATTCTACCTCTGTTACAAAAGGTGA...

CDS

Download CDS FASTA

1896 bp · TkA08G053750|TK1151|CDS

CTCATTTTGTTTTCAGTTCTTCTCCTATCTTTACTTGCATCTTTTGTTTCAGGTCAAGTGTTTTGGAGTGTAAACTGTGGGGAATCAGAGATCTACACTGATAGTAACCTAATGATTTGGACGCCGGACGCAACTCTAATCTCCAATGGGGTTGCTCGAGTGGTTCAGTCAAGTAATAAAATATCTACAGTGCTAGACTCTCTTAGAGTTTTCACTAGTCGAAAAAAGAATTGCTATTCTACCTCTGTTACAAAAGGTGA...

Protein

Download Protein FASTA

631 aa · TkA08G053750|TK1151|PROTEIN

LILFSVLLLSLLASFVSGQVFWSVNCGESEIYTDSNLMIWTPDATLISNGVARVVQSSNKISTVLDSLRVFTSRKKNCYSTSVTKGEKLLVRASFNYGNYDRLSSPPTFDLHFDGNFWTTVQTLISGANAYEATYVAKGDSVSVCVAQTKSGQFPFMSALEVRSIDSDAYSILDENRALFLIGRISYGADKTLRFPQDLYDRIWVPSLAGGTKKVTNNAILVDSTGTNNPPSGIFENAVTVDSTTESLLLATISPTNTPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G053750`
TK1151 ID	TkA08G053750
OH-1004 ID	LXL04_017733
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 99.683 / OH-1004 95.738 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G053750

Location Chr08:13743966-13748668 (-)

Description Similar to At2g19230: Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59650`	Required for accurate photosynthesis.	No verified direct reference in this release
`At2g19190`	Involved in innate immune response of plants.	No verified direct reference in this release
`At5g16900`	Probable LRR receptor-like serine/threonine-protein kinase At5g16900.	No verified direct reference in this release
`At3g08680`	Probable inactive receptor kinase At3g08680.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017733 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G07560

ath:AT1G51860

ath:AT2G19190

ath:AT2G19210

ath:AT2G19230

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.730

Rank 1 · TkA08G053750 · TK1151

Extracellular0.112

Rank 2 · TkA08G053750 · TK1151

Endoplasmic reticulum0.090

Rank 3 · TkA08G053750 · TK1151

Cytoplasm0.086

Rank 4 · TkA08G053750 · TK1151

Lysosome / Vacuole0.041

Rank 5 · TkA08G053750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17870Insulin_TMD8-22 aa

PF12819Malectin_like24-342 aa

PF00560LRR_157-65 aa

PF12799LRR_4316-325 aa

PF12799LRR_4395-430 aa

PF00560LRR_1397-413 aa

PF13855LRR_8418-453 aa

PF00560LRR_1420-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G053750	`PF17870`	Insulin_TMD	8	22	0.0095	16.7
TkA08G053750	`PF12819`	Malectin_like	24	342	1.1e-68	232.6
TkA08G053750	`PF00560`	LRR_1	57	65	7.8e-05	22.8
TkA08G053750	`PF12799`	LRR_4	316	325	9.3e-05	23.3
TkA08G053750	`PF12799`	LRR_4	395	430	9.3e-05	23.3
TkA08G053750	`PF00560`	LRR_1	397	413	7.8e-05	22.8
TkA08G053750	`PF13855`	LRR_8	418	453	0.0015	18.9
TkA08G053750	`PF00560`	LRR_1	420	440	7.8e-05	22.8
TkA08G053750	`PF12799`	LRR_4	420	456	9.3e-05	23.3
TkA08G053750	`PF00560`	LRR_1	443	464	7.8e-05	22.8
TkA08G053750	`PF17870`	Insulin_TMD	506	539	0.0095	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGW2`	Arabidopsis thaliana	sp\|C0LGW2\|PAM74_ARATH Probable LRR receptor-like serine/threonine-protein kinase PAM74	32.100%	Swiss-Prot	Medium
`O64483`	Arabidopsis thaliana	sp\|O64483\|SIRK_ARATH Senescence-induced receptor-like serine/threonine-protein kinase	30.200%	Swiss-Prot	Medium
`C0LGT5`	Arabidopsis thaliana	sp\|C0LGT5\|Y5169_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g16900	26.700%	Swiss-Prot	Low
`Q9C9Y8`	Arabidopsis thaliana	sp\|Q9C9Y8\|Y3868_ARATH Probable inactive receptor kinase At3g08680	39.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card