TkA08G053270 | RubberDandelionOmics

Gene overview

TkA08G053270

Reference: TK1151 Chr: Chr08 Coordinates: 13636968-13641290 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2994 bp · TkA08G053270|TK1151|cDNA

ATGTTCTGGACTCCGCAGCAAGGTGCGGCGGAGCCCCTTACTCCGGTGTTGGAGAAACCCGAAGTTCCAGACTCGCCGTTGCCTTACTTAGACACAACCACCAGTCGCCGGAATTTCGTCGGAGGCAACGATGATAACAAGGAGGAGGAAGTGATTCCGCCTTCAGCTGTGCCGTTTCTGGCGTTGTTTTCCTGTGCAGATGGACTTGATTTTCTTCTGATTATGTTGGGGTCGGTGGGTGCTGTTGTTCATGGCGCATC...

CDS

Download CDS FASTA

2994 bp · TkA08G053270|TK1151|CDS

ATGTTCTGGACTCCGCAGCAAGGTGCGGCGGAGCCCCTTACTCCGGTGTTGGAGAAACCCGAAGTTCCAGACTCGCCGTTGCCTTACTTAGACACAACCACCAGTCGCCGGAATTTCGTCGGAGGCAACGATGATAACAAGGAGGAGGAAGTGATTCCGCCTTCAGCTGTGCCGTTTCTGGCGTTGTTTTCCTGTGCAGATGGACTTGATTTTCTTCTGATTATGTTGGGGTCGGTGGGTGCTGTTGTTCATGGCGCATC...

Protein

Download Protein FASTA

997 aa · TkA08G053270|TK1151|PROTEIN

MFWTPQQGAAEPLTPVLEKPEVPDSPLPYLDTTTSRRNFVGGNDDNKEEEVIPPSAVPFLALFSCADGLDFLLIMLGSVGAVVHGASLVVYLHLFGKIIHLLSGSFRISHELFDVFNIQYALYIVYTGLTVFASGWMEVWCWILTAERQTAVIRTKYVQVILNQNMTFFDTYGNNGDIVNEVLTDVQVIQCVIGEKVGNYIQHIATCVGGLVIAFLNCWQISFVALATAPIIIGTSGISNVFYHRFQENLQDANDHSANV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G053270`
TK1151 ID	TkA08G053270
OH-1004 ID	LXL04_017744
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.800
Protein coverage (%)	TK1151 98.596 / OH-1004 77.981 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G053270

Location Chr08:13636968-13641290 (-)

Description Similar to ABCB19: ABC transporter B family member 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39480`	Probable auxin efflux transporter that contributes, together with ABCB20 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At3g55320`	Probable auxin efflux transporter that contributes, together with ABCB6 and in a FKBP42/TWD1-dependent manner, to the regulation of leaf position and morphology, internode distribution, roots development, and inflorescence organization, probably by modulating auxin repartition.	Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260
`At2g36910`	May participate in brassinosteroid export and related signaling.	Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181
`At3g28860`	May participate in brassinosteroid export and related signaling.	TWISTED DWARF1, a unique plasma membrane-anchored immunophilin-like protein, interacts with Arabidopsis multidrug resistance-like transporters AtPGP1 and AtPGP19.2003 · DOI: 10.1091/mbc.e02-10-0698 Connective auxin transport contributes to strigolactone-mediated shoot branching control independent of the transcription factor BRC1.2019 · DOI: 10.1371/journal.pgen.1008023 An ATP-Binding Cassette Transporter, ABCB19, Regulates Leaf Position and Morphology during Phototropin1-Mediated Blue Light Responses.2020 · DOI: 10.1104/pp.20.00223 Arabidopsis TWISTED DWARF1 regulates stamen elongation by differential activation of ABCB1,19-mediated auxin transport.2022 · DOI: 10.1093/jxb/erac185 Loss of Multiple ABCB Auxin Transporters Recapitulates the Major twisted dwarf 1 Phenotypes in Arabidopsis thaliana .2022 · DOI: 10.3389/fpls.2022.840260 Structure and function of the <i>Arabidopsis</i> ABC transporter ABCB19 in brassinosteroid export.2024 · DOI: 10.1126/science.adj4591 ABCB19 transporter: fostering brassinosteroid transport through membrane flexibility.2024 · DOI: 10.1016/j.tplants.2024.06.005 Structural insights into brassinosteroid export mediated by the Arabidopsis ABC transporter ABCB1.2025 · DOI: 10.1016/j.xplc.2024.101181 Quantitative analysis of the root posture of Arabidopsis thaliana mutants with wavy roots.2024 · DOI: 10.1017/qpb.2024.12
`At1g27940`	ABC transporter B family member 13.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017744 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008361 regulation of cell size Biological Process

GO:0009555 pollen development Biological Process

GO:0009637 response to blue light Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010218 response to far red light Biological Process

KEGG gene cross-reference

ath:AT1G27940

ath:AT3G28860

ath:AT4G25960

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.360

Rank 1 · TkA08G053270 · TK1151

Lysosome / Vacuole0.316

Rank 2 · TkA08G053270 · TK1151

Endoplasmic reticulum0.161

Rank 3 · TkA08G053270 · TK1151

Cytoplasm0.118

Rank 4 · TkA08G053270 · TK1151

Golgi apparatus0.082

Rank 5 · TkA08G053270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00664ABC_membrane76-345 aa

PF00005ABC_tran420-569 aa

PF06414Zeta_toxin429-466 aa

PF02463SMC_N430-447 aa

PF01935DUF87431-464 aa

PF07693KAP_NTPase431-617 aa

PF00931NB-ARC431-453 aa

PF13401AAA_22432-486 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G053270	`PF00664`	ABC_membrane	76	345	9.7e-75	252.5
TkA08G053270	`PF00005`	ABC_tran	420	569	3.4e-21	77.0
TkA08G053270	`PF06414`	Zeta_toxin	429	466	0.1	12.7
TkA08G053270	`PF02463`	SMC_N	430	447	0.012	15.7
TkA08G053270	`PF01935`	DUF87	431	464	0.061	14.1
TkA08G053270	`PF07693`	KAP_NTPase	431	617	0.18	11.7
TkA08G053270	`PF00931`	NB-ARC	431	453	0.26	11.5
TkA08G053270	`PF13401`	AAA_22	432	486	0.072	14.1
TkA08G053270	`PF00931`	NB-ARC	541	575	0.26	11.5
TkA08G053270	`PF02463`	SMC_N	555	587	0.012	15.7
TkA08G053270	`PF00664`	ABC_membrane	689	947	9.7e-75	252.5
TkA08G053270	`PF29952`	KIAA1549_1st	903	951	0.047	14.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPT1`	Arabidopsis thaliana	sp\|Q8LPT1\|AB6B_ARATH ABC transporter B family member 6	51.500%	Swiss-Prot	High
`Q9M3B9`	Arabidopsis thaliana	sp\|Q9M3B9\|AB20B_ARATH ABC transporter B family member 20	50.600%	Swiss-Prot	High
`Q9ZR72`	Arabidopsis thaliana	sp\|Q9ZR72\|AB1B_ARATH ABC transporter B family member 1	35.400%	Swiss-Prot	Medium
`Q9LJX0`	Arabidopsis thaliana	sp\|Q9LJX0\|AB19B_ARATH ABC transporter B family member 19	35.200%	Swiss-Prot	Medium
`Q9C7F8`	Arabidopsis thaliana	sp\|Q9C7F8\|AB13B_ARATH ABC transporter B family member 13	35.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card