TkA08G053230 | RubberDandelionOmics

Gene overview

TkA08G053230

Reference: TK1151 Chr: Chr08 Coordinates: 13626766-13628043 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1095 bp · TkA08G053230|TK1151|cDNA

AAACCGGTTACCGTCTAGCAACCGGCTAATTTCCCCCTAAACCGTTCATAATACACCACTATATATAACTGCCACTTGAGCAAAGTCCAATGCAAGCTTCTACTCCCTCACTCAAATACTAAAAAAAAACATATTACACAAAAAAAAAAAAAAAAAAAAAAGTTGAGAAAATGCCAATTTCAAGTATTTCCCTTGGATCTCCGGCGGACGCTAGCTCGCCGGACGCCCTCAAAGCCGCCCTTGCAGAGTTTATTTCAATG...

CDS

Download CDS FASTA

759 bp · TkA08G053230|TK1151|CDS

ATGCCAATTTCAAGTATTTCCCTTGGATCTCCGGCGGACGCTAGCTCGCCGGACGCCCTCAAAGCCGCCCTTGCAGAGTTTATTTCAATGCTCATTTTTGTTTTTGCCGGTGAAGGTGCCGGCATGGCTTTTGGAAAGTTGACGGATGGTGGTGCGGCAACACCAGCGGGTCTTATTTCAGCATCGATAGCCCATGCTTTTGCACTATTTGTGGCGGTGTCAGTCGGTGCTAATATTTCAGGAGGTCACGTGAACCCCGC...

Protein

Download Protein FASTA

252 aa · TkA08G053230|TK1151|PROTEIN

MPISSISLGSPADASSPDALKAALAEFISMLIFVFAGEGAGMAFGKLTDGGAATPAGLISASIAHAFALFVAVSVGANISGGHVNPAVTFGAFVGGHISFMRSVLYWIAQCLGSVVACLLLKFATGGLETSAFALSSGVGEWNAVVFEIVMTFGLVYTVYATAVDPKKGDLGIIAPLAIGFIVGANILAGGAFDGASMNPAVSFGPAVVSWTWNSHWVYWLGPFVGAAIAALIYEIIFIGSSTHEPLPITDY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G053230`
TK1151 ID	TkA08G053230
OH-1004 ID	LXL04_017745
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G053230

Location Chr08:13626766-13628043 (-)

Description Similar to TIP1-3: Aquaporin TIP1-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g01470`	Potential aquaporin, which may facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At2g36830`	Water channel required to facilitate the transport of water, diffusion of amino acids and/or peptides from the vacuolar compartment to the cytoplasm.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0975900`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0015840 urea transport Biological Process

GO:0080170 hydrogen peroxide transmembrane transport Biological Process

GO:1902074 response to salt Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0000326 protein storage vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT2G36830

ath:AT4G01470

dosa:Os01g0975900

zma:541893

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.619

Rank 1 · TkA08G053230 · TK1151

Cell membrane0.170

Rank 2 · TkA08G053230 · TK1151

Endoplasmic reticulum0.123

Rank 3 · TkA08G053230 · TK1151

Cytoplasm0.082

Rank 4 · TkA08G053230 · TK1151

Golgi apparatus0.060

Rank 5 · TkA08G053230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP15-234 aa

PF23809Phage_holin_942-74 aa

PF30972DUF877074-107 aa

PF23809Phage_holin_999-118 aa

PF23809Phage_holin_9123-169 aa

PF30972DUF8770181-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G053230	`PF00230`	MIP	15	234	5e-77	259.3
TkA08G053230	`PF23809`	Phage_holin_9	42	74	4.4	7.8
TkA08G053230	`PF30972`	DUF8770	74	107	0.05	14.0
TkA08G053230	`PF23809`	Phage_holin_9	99	118	4.4	7.8
TkA08G053230	`PF23809`	Phage_holin_9	123	169	4.4	7.8
TkA08G053230	`PF30972`	DUF8770	181	220	0.05	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82598`	Arabidopsis thaliana	sp\|O82598\|TIP13_ARATH Aquaporin TIP1-3	77.000%	Swiss-Prot	High
`P25818`	Arabidopsis thaliana	sp\|P25818\|TIP11_ARATH Aquaporin TIP1-1	75.800%	Swiss-Prot	High
`Q94CS9`	Oryza sativa subsp. japonica	sp\|Q94CS9\|TIP12_ORYSJ Probable aquaporin TIP1-2	79.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card