TkA08G052360 | RubberDandelionOmics

Gene overview

TkA08G052360

Reference: TK1151 Chr: Chr08 Coordinates: 13369123-13374645 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2255 bp · TkA08G052360|TK1151|cDNA

TCTTATGCCACCTAAATTGGAACAAAGTCGTTGTCATCCTCTTTGCCACTTAGAAATAGAGGTTGTCAATATACATCATGAATGAAGTTTTCTACAATAAAACTAAGTGAAATGAATAGGATCATGCCACCTGCTCCAACTGACGTGGATGGCTTCACATTCAGACAGCGCCGACACAAATAAACCAAACCCCAACTAAATTAAACACCAAGGTCTCTCAGATCAATAATGCGATTGCGACATCCGTTTCAATTACAGTT...

CDS

Download CDS FASTA

1419 bp · TkA08G052360|TK1151|CDS

ATGGCAGACTCATTTCACAATCATGTTCCAACTACAACAAGCTCTGAACGACCAAGTTCCAAACTAACTTTGGTTGCATCTTCCTCCAAGTCTTTCTCCCACAAATCCTTAAAACAAATTCCTTTTTTTAACTCTGGAAAAATAAAAAAAGTACCCATAAATGACGTGGCATTGTTTTTACTAAAAGTCGGCGCCTTGGAGACAGTAAGGAGATTATCAAACCACAAGTGCCCTTTTATATGGTCCACTTTGCAAACACT...

Protein

Download Protein FASTA

472 aa · TkA08G052360|TK1151|PROTEIN

MADSFHNHVPTTTSSERPSSKLTLVASSSKSFSHKSLKQIPFFNSGKIKKVPINDVALFLLKVGALETVRRLSNHKCPFIWSTLQTLQVFCYPPLKWLQKWVPFRNLIKNMQMLSRPLLVISIATTFSNHSDQTNLDSDDNDNDNDTENSDESDDHNVQEPTQPSIDVQLQALGLPRHPSTNWLVDLYKELDNQGLHLPERINEGELYRFHFAANGDFSSLVAMVKKSINWRKSYRILSQEELEAWGNMVFWHGTDVENR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G052360`
TK1151 ID	TkA08G052360
OH-1004 ID	LXL04_017765
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G052360`
Location	Chr08:13369123-13374645 (+)
Description	Similar to SFH2: Phosphatidylinositol/phosphatidylcholine transfer protein SFH2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017765` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006656 phosphatidylcholine biosynthetic process Biological Process GO:0006892 post-Golgi vesicle-mediated transport Biological Process GO:0009932 cell tip growth Biological Process GO:0010053 root epidermal cell differentiation Biological Process GO:0015031 protein transport Biological Process GO:0048767 root hair elongation Biological Process GO:0048768 root hair cell tip growth Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component
KEGG gene cross-reference	ath:AT1G19650 ath:AT2G21520 ath:AT4G34580 ath:AT4G36490 ath:AT4G39180 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.322

Rank 1 · TkA08G052360 · TK1151

Mitochondrion0.190

Rank 2 · TkA08G052360 · TK1151

Nucleus0.146

Rank 3 · TkA08G052360 · TK1151

Cytoplasm0.141

Rank 4 · TkA08G052360 · TK1151

Plastid0.126

Rank 5 · TkA08G052360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23242AAA_lid_TRIP13_C9-60 aa

PF13716CRAL_TRIO_231-42 aa

PF13716CRAL_TRIO_2166-194 aa

PF00650CRAL_TRIO247-392 aa

PF13716CRAL_TRIO_2300-371 aa

PF13691Lactamase_B_4426-446 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G052360	`PF23242`	AAA_lid_TRIP13_C	9	60	0.16	12.9
TkA08G052360	`PF13716`	CRAL_TRIO_2	31	42	1.9e-05	25.7
TkA08G052360	`PF13716`	CRAL_TRIO_2	166	194	1.9e-05	25.7
TkA08G052360	`PF00650`	CRAL_TRIO	247	392	1.1e-24	87.7
TkA08G052360	`PF13716`	CRAL_TRIO_2	300	371	1.9e-05	25.7
TkA08G052360	`PF13691`	Lactamase_B_4	426	446	0.24	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card