TkA08G052130 | RubberDandelionOmics

Gene overview

TkA08G052130

Reference: TK1151 Chr: Chr08 Coordinates: 13319411-13321085 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1349 bp · TkA08G052130|TK1151|cDNA

TGAGACCCAATACGAAGTTATACCCGGATACCTCTATTCGAGCTTCACTCTGTCGATCTCTTCTTCCATGCCGGACTGACGGTCTCACCGCAACCTATCTGTCGTCAATCTTCAGTCTTCACCGGAGTGAGCTTCGCCACTGCCGGAGACCGCCTGGCGCTGCTTCTTCTCTCTCTAAATCGGTTCAGACATATTGGACCTTCAACCAATTCCGCGAACAAAATGAATAAATTTAGCAGCCTTTCGACTCTAATCAACCG...

CDS

Download CDS FASTA

879 bp · TkA08G052130|TK1151|CDS

ATGAATAAATTTAGCAGCCTTTCGACTCTAATCAACCGCCGATGCTCCACCACAGCCACAACCCATCTCAGACGGCTATCAACCAAGCCCTCCGATGGCCGAGACGAATGGAACGACGCGTGGGAAACAGCGTGGCTCCCTGAAGACCTATCGGGGAAAAACCGAGCACCATGGGAAACAGACGTCAATTTCTCCATCGCCGATACACCAGAGGCTCTCGATCCAGACACAAAGGCGTTCGTTGAAGACATGAGTGATAA...

Protein

Download Protein FASTA

292 aa · TkA08G052130|TK1151|PROTEIN

MNKFSSLSTLINRRCSTTATTHLRRLSTKPSDGRDEWNDAWETAWLPEDLSGKNRAPWETDVNFSIADTPEALDPDTKAFVEDMSDNWEQRRKKPGSKSKREEEEDRLLKMKEEGKSLYSLENVKNDYRVMKQRVHASLWVKEIEKMEEAKLGDSGGAGGDDLDRFLDSASEIFDDSSNSEPTDLKNKPDGWETTSKTQDGNIWEMTQREEDILLQEYERRIAFSKFQIASFIKQHVFSRRRPIDGWKYMIEELGPNARR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G052130`
TK1151 ID	TkA08G052130
OH-1004 ID	LXL04_017769
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.300
Protein coverage (%)	TK1151 100.000 / OH-1004 71.498 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G052130

Location Chr08:13319411-13321085 (+)

Description Similar to GCD1: Protein GAMETE CELL DEFECTIVE 1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62270`	Essential for fertility (male and female gametophyte functions and development).	Mitochondrial GCD1 dysfunction reveals reciprocal cell-to-cell signaling during the maturation of Arabidopsis female gametes.2012 · DOI: 10.1016/j.devcel.2012.09.011

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0801700`	Essential for fertility (male and female gametophyte functions and development).	OsGCD1 is essential for rice fertility and required for embryo dorsal-ventral pattern formation and endosperm development.2017 · DOI: 10.1111/nph.14625 The stereotyped positioning of the generative cell associated with vacuole dynamics is not required for male gametogenesis in rice pollen.2018 · DOI: 10.1111/nph.15038
`UniProt: A2WW22`	Essential for fertility (male and female gametophyte functions and development) (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017769 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007006 mitochondrial membrane organization Biological Process

GO:0007033 vacuole organization Biological Process

GO:0007154 cell communication Biological Process

GO:0009555 pollen development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009846 pollen germination Biological Process

GO:0009960 endosperm development Biological Process

GO:0010342 endosperm cellularization Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0048229 gametophyte development Biological Process

KEGG gene cross-reference

ath:AT5G62270

dosa:Os01g0801700

osa:4327965

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.921

Rank 1 · TkA08G052130 · TK1151

Nucleus0.081

Rank 2 · TkA08G052130 · TK1151

Cytoplasm0.058

Rank 3 · TkA08G052130 · TK1151

Cell membrane0.015

Rank 4 · TkA08G052130 · TK1151

Plastid0.013

Rank 5 · TkA08G052130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15590Imm2721-38 aa

PF15590Imm2782-93 aa

PF15590Imm27184-211 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G052130	`PF15590`	Imm27	21	38	0.34	11.4
TkA08G052130	`PF15590`	Imm27	82	93	0.34	11.4
TkA08G052130	`PF15590`	Imm27	184	211	0.34	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVA9`	Arabidopsis thaliana	sp\|Q9LVA9\|GCD1_ARATH Small ribosomal subunit protein mS75	36.000%	Swiss-Prot	Medium
`Q8S2G4`	Oryza sativa subsp. japonica	sp\|Q8S2G4\|GCD1_ORYSJ Protein GAMETE CELL DEFECTIVE 1, mitochondrial	32.300%	Swiss-Prot	Medium
`A2WW22`	Oryza sativa subsp. indica	sp\|A2WW22\|GCD1_ORYSI Protein GAMETE CELL DEFECTIVE 1, mitochondrial	32.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card