TkA08G049540 | RubberDandelionOmics

Gene overview

TkA08G049540

Reference: TK1151 Chr: Chr08 Coordinates: 12589620-12591163 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

849 bp · TkA08G049540|TK1151|cDNA

CAATTTCACATTTCACATTATAAAATCTTAAAAATTCTTATTTATACAGCTAATAAAGTGTTCGGTTTTGTGGTGGCGGTGGTGCACCAATTTACGAGAGTACATGACAAATTTACTCTATCCCCTTGCGGCAAATTCAATTAAAGGTACAAAAAGGCGTGACTGTGGGTGTGTACAAGACAACTCCAAGAACTGAAGATGCCGCGCAAGACCTTCATGGGTTCGTTATCTTCTCCCAAGGTGGATGTCATCATCGATAC...

CDS

Download CDS FASTA

438 bp · TkA08G049540|TK1151|CDS

ATGCCGCGCAAGACCTTCATGGGTTCGTTATCTTCTCCCAAGGTGGATGTCATCATCGATACCGGAAATCCTCTCCTCAATCACTCCGTCGATGGCTTCTTAAGGATCGGAACTGTTGCCGCTGCAAAAACAGTTGCCGAGGAGACTTATCACGTGGTCAAACGAGGAAGCGTTTCAAAACATAACCTTGAGGACTCGTTAAAGAAGATGTGTAAAGAAGGCGCATACTGGGGATCGATAGCTGGACTATATGTTGGAAT...

Protein

Download Protein FASTA

145 aa · TkA08G049540|TK1151|PROTEIN

MPRKTFMGSLSSPKVDVIIDTGNPLLNHSVDGFLRIGTVAAAKTVAEETYHVVKRGSVSKHNLEDSLKKMCKEGAYWGSIAGLYVGMEYGVERVRGTRDWNAMIGGALTGAIVSAVSNKKGDKIVMDAIAGGAVATAAEFINYLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G049540`
TK1151 ID	TkA08G049540
OH-1004 ID	LXL04_021468
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.800
Protein coverage (%)	TK1151 38.621 / OH-1004 80.952 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G049540

Location Chr08:12589620-12591163 (+)

Description Similar to OEP161: Outer envelope pore protein 16-1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28900`	Voltage-dependent high-conductance channel with a slight cation-selectivity; selective for amino acids but excludes triosephosphates or uncharged sugars (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021468 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0009409 response to cold Biological Process

GO:0009611 response to wounding Biological Process

GO:0009744 response to sucrose Biological Process

GO:0009749 response to glucose Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009527 plastid outer membrane Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT2G28900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.670

Rank 1 · TkA08G049540 · TK1151

Plastid0.251

Rank 2 · TkA08G049540 · TK1151

Cytoplasm0.065

Rank 3 · TkA08G049540 · TK1151

Nucleus0.034

Rank 4 · TkA08G049540 · TK1151

Cell membrane0.019

Rank 5 · TkA08G049540 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466Tim1746-134 aa

PF13441Gly-zipper_YMGG73-90 aa

PF05818TraT97-139 aa

PF19814DUF6297102-138 aa

PF13441Gly-zipper_YMGG105-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G049540	`PF02466`	Tim17	46	134	8.2e-13	49.4
TkA08G049540	`PF13441`	Gly-zipper_YMGG	73	90	0.69	10.7
TkA08G049540	`PF05818`	TraT	97	139	0.53	10.7
TkA08G049540	`PF19814`	DUF6297	102	138	0.048	13.2
TkA08G049540	`PF13441`	Gly-zipper_YMGG	105	134	0.69	10.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV24`	Arabidopsis thaliana	sp\|Q9ZV24\|OP161_ARATH Outer envelope pore protein 16-1, chloroplastic	57.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card