TkA08G049080 | RubberDandelionOmics

Gene overview

TkA08G049080

Reference: TK1151 Chr: Chr08 Coordinates: 12480814-12482404 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · TkA08G049080|TK1151|cDNA

ATGGAGTATGTGGGATCAACAACTAAAATCACTGATTTAGAGGACAATAAGGAAGAGTCGGTTGTTTGGCCTTTGATGGTAGTGGTAGCCAACATTCCATTTGAACACAAGGATGATTTTTATTTGGATGATGGTTTTTTGGGTGATAGTGCTAAGAATCTAAAGGATGAGTGGATAAAAGATGGGTACAAACCCGTAAAAGTTTATCCATTGTGGAGCTCTTTGGGACACTCAGGATTTGCTATTGTTGAATTTGGACA...

CDS

Download CDS FASTA

1014 bp · TkA08G049080|TK1151|CDS

ATGGAGTATGTGGGATCAACAACTAAAATCACTGATTTAGAGGACAATAAGGAAGAGTCGGTTGTTTGGCCTTTGATGGTAGTGGTAGCCAACATTCCATTTGAACACAAGGATGATTTTTATTTGGATGATGGTTTTTTGGGTGATAGTGCTAAGAATCTAAAGGATGAGTGGATAAAAGATGGGTACAAACCCGTAAAAGTTTATCCATTGTGGAGCTCTTTGGGACACTCAGGATTTGCTATTGTTGAATTTGGACA...

Protein

Download Protein FASTA

337 aa · TkA08G049080|TK1151|PROTEIN

MEYVGSTTKITDLEDNKEESVVWPLMVVVANIPFEHKDDFYLDDGFLGDSAKNLKDEWIKDGYKPVKVYPLWSSLGHSGFAIVEFGQELDGFNNTKMFVNDFEVDKHGRKDWYNSNRCIDDNKLYAWIANDEDYYSSGIVGVFLRKNGILKAVSTIEKENEVKNINVILGLKTRLEEMSETTKEIQSQVSTTNSHVDFFMKQNVILIQNFNKDLKKLQEKGKKIITKLQHEDGDKKMRDNEKLGKQITELQKKVDDKELE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G049080`
TK1151 ID	TkA08G049080
OH-1004 ID	LXL04_017806
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.300
Protein coverage (%)	TK1151 98.813 / OH-1004 37.363 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G049080

Location Chr08:12480814-12482404 (-)

Description Similar to FDM4: Factor of DNA methylation 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13790`	Acts in association with FDM3 and FDM5 for RNA-directed DNA methylation (RdDM).	A subgroup of SGS3-like proteins act redundantly in RNA-directed DNA methylation.2012 · DOI: 10.1093/nar/gks034

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017806 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0032259 methylation Biological Process

GO:0080188 gene silencing by siRNA-directed DNA methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0008168 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G13790

ath:AT3G12550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.628

Rank 1 · TkA08G049080 · TK1151

Nucleus0.333

Rank 2 · TkA08G049080 · TK1151

Cell membrane0.076

Rank 3 · TkA08G049080 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA08G049080 · TK1151

Mitochondrion0.036

Rank 5 · TkA08G049080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03468XS18-135 aa

PF20302HisK-N-like154-205 aa

PF30671CCDC170_1st157-315 aa

PF00435Spectrin158-195 aa

PF25481Nucleoprot-TPR164-197 aa

PF28006HpsJ167-304 aa

PF08941USP8_interact172-221 aa

PF26095CC_Bre1172-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G049080	`PF03468`	XS	18	135	3.6e-29	102.1
TkA08G049080	`PF20302`	HisK-N-like	154	205	8.6	7.3
TkA08G049080	`PF30671`	CCDC170_1st	157	315	0.00058	20.1
TkA08G049080	`PF00435`	Spectrin	158	195	0.1	13.8
TkA08G049080	`PF25481`	Nucleoprot-TPR	164	197	9.8	7.0
TkA08G049080	`PF28006`	HpsJ	167	304	5.2	7.4
TkA08G049080	`PF08941`	USP8_interact	172	221	0.38	11.2
TkA08G049080	`PF26095`	CC_Bre1	172	193	2.0	9.4
TkA08G049080	`PF16515`	HIP1_clath_bdg	173	225	5.7	8.1
TkA08G049080	`PF23323`	Spectrin_6	176	263	4.6	8.2
TkA08G049080	`PF08840`	BAAT_C	178	298	1.6	9.4
TkA08G049080	`PF03468`	XS	203	219	3.6e-29	102.1
TkA08G049080	`PF00435`	Spectrin	207	300	0.1	13.8
TkA08G049080	`PF26095`	CC_Bre1	207	265	2.0	9.4
TkA08G049080	`PF27241`	CLIP1	209	311	4.2	8.1
TkA08G049080	`PF19443`	DAHL	212	327	0.051	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMH6`	Arabidopsis thaliana	sp\|Q9LMH6\|FDM4_ARATH Factor of DNA methylation 4	32.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card