TkA08G047850 | RubberDandelionOmics

Gene overview

TkA08G047850

Reference: TK1151 Chr: Chr08 Coordinates: 12159186-12163296 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2261 bp · TkA08G047850|TK1151|cDNA

CTTTTACCGATACATCCGGTAACAAGGGTCAATGAGTATAAACAGTTGGGGGTTTAAGGCCAATGGTTGGGTGGTTTTCAGAGGGTTTTTGTTTTTCATCCTCATCTCTCATCTCTCAACTATAATTCATCGTCTTTTCAAGGATTTCTAGATAGAGAAAGTGAAATAAGAGAGAGAAAATTAAGAAGAGGTTGCGTCTGAAACAAATCAAACAACATTTTGCTGTTTGAAGGACAAAATGAGATTTAATAATCGAGGGT...

CDS

Download CDS FASTA

1521 bp · TkA08G047850|TK1151|CDS

ATGGTGTTGCAAAAGAGATTAGAATATGGATTCAACGGTTACCAGATACCCCCAACGCCTCGCGCTCCCAGATCAGCCAGGAAACGAGCTTCATCGTGGAAGAAGAACGAAGATCATAATCCCATGTTTGCATTCGACTTACTAGCAACTGTCGCTGGTGACTTATTGGGTGACGAGTTAAATAAAAAAGAAACGATTAAAAAAGAAGAAAATGTTTACGATCAAGGAAGCTGTAATAAAACCTTTTTCGTATCTGAAAT...

Protein

Download Protein FASTA

506 aa · TkA08G047850|TK1151|PROTEIN

MVLQKRLEYGFNGYQIPPTPRAPRSARKRASSWKKNEDHNPMFAFDLLATVAGDLLGDELNKKETIKKEENVYDQGSCNKTFFVSEIISKPPVTNSGPASGITVSDFSDKKVPIPKPVEICKIEEINNKEASTNGKPPPVNNLDSNNVDLVVRDDDENSCGCTQINKKLIGPPSRIGDRRFRRLLASKQWKNGPKLNDDYRNKKSFYKHQRSLRDYPFKKRKLYQFDNPSNSNEVGPTSQDPTFQSQDSHVKLKIKSFRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G047850`
TK1151 ID	TkA08G047850
OH-1004 ID	LXL04_017821
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.800
Protein coverage (%)	TK1151 97.233 / OH-1004 91.423 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G047850

Location Chr08:12159186-12163296 (+)

Description Similar to TRP2: Telomere repeat-binding protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46590`	Binds specifically to the plant telomeric double-stranded DNA sequences.	AtTBP2 and AtTRP2 in Arabidopsis encode proteins that bind plant telomeric DNA and induce DNA bending in vitro.2005 · DOI: 10.1007/s00438-004-1096-3
`At1g07540`	Binds specifically to the plant telomeric double-stranded DNA sequences.	No verified direct reference in this release
`At5g59430`	Binds specifically to the plant telomeric double-stranded DNA sequences 5'-GGTTTAG-3'.	No verified direct reference in this release
`At3g12560`	Binds specifically to the plant telomeric double-stranded DNA sequences.	No verified direct reference in this release
`At5g13820`	Binds specifically to the plant telomeric double-stranded DNA sequences 5'-TTTAGGG-3'.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017821 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003691 double-stranded telomeric DNA binding Molecular Function

GO:0008301 DNA binding, bending Molecular Function

KEGG gene cross-reference

ath:AT1G07540

ath:AT3G12560

ath:AT3G46590

ath:AT5G13820

ath:AT5G59430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · TkA08G047850 · TK1151

Cytoplasm0.065

Rank 2 · TkA08G047850 · TK1151

Cell membrane0.023

Rank 3 · TkA08G047850 · TK1151

Endoplasmic reticulum0.016

Rank 4 · TkA08G047850 · TK1151

Plastid0.012

Rank 5 · TkA08G047850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18036Ubiquitin_4247-318 aa

PF23603Ubiquitin_TPR1250-318 aa

PF00240ubiquitin253-321 aa

PF00249Myb_DNA-binding357-370 aa

PF00249Myb_DNA-binding405-454 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G047850	`PF18036`	Ubiquitin_4	247	318	0.0028	18.3
TkA08G047850	`PF23603`	Ubiquitin_TPR1	250	318	1.2e-38	131.3
TkA08G047850	`PF00240`	ubiquitin	253	321	0.0011	19.5
TkA08G047850	`PF00249`	Myb_DNA-binding	357	370	7e-06	26.8
TkA08G047850	`PF00249`	Myb_DNA-binding	405	454	7e-06	26.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SNB9`	Arabidopsis thaliana	sp\|Q9SNB9\|TRP2_ARATH Telomere repeat-binding protein 2	47.600%	Swiss-Prot	Medium
`Q6R0E3`	Arabidopsis thaliana	sp\|Q6R0E3\|TRP5_ARATH Telomere repeat-binding protein 5	42.700%	Swiss-Prot	Medium
`Q8L7L8`	Arabidopsis thaliana	sp\|Q8L7L8\|TRP1_ARATH Telomere repeat-binding protein 1	44.000%	Swiss-Prot	Medium
`Q9C7B1`	Arabidopsis thaliana	sp\|Q9C7B1\|TRP3_ARATH Telomere repeat-binding protein 3	45.300%	Swiss-Prot	Medium
`Q9FFY9`	Arabidopsis thaliana	sp\|Q9FFY9\|TRP4_ARATH Telomere repeat-binding protein 4	44.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card