TkA08G044660 | RubberDandelionOmics

Gene overview

TkA08G044660

Reference: TK1151 Chr: Chr08 Coordinates: 11396024-11397450 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · TkA08G044660|TK1151|cDNA

ATAAAGTCCAAACCCTTACTCCCACCCTCTGAGTTTTTGGCTTCCCCGCGTCTTTCAAGCCCTAACCCTAGTTTTTTCACCGGAAAACTTAATCTCTCGCCGGAGAAATGTTGGAGCTGAGGCTAGTTCAGGGGAGTCTCCTGAAGAAGGTGATGGAGTCGATCAAGGACCTGGTGAACGATGCCAACTTTGACTGCTCCGCCACGGGGTTTTCGCTACAGGCGATGGACTCCAGCCACGTGGCGCTGGTATCGCTCCTT...

CDS

Download CDS FASTA

795 bp · TkA08G044660|TK1151|CDS

ATGTTGGAGCTGAGGCTAGTTCAGGGGAGTCTCCTGAAGAAGGTGATGGAGTCGATCAAGGACCTGGTGAACGATGCCAACTTTGACTGCTCCGCCACGGGGTTTTCGCTACAGGCGATGGACTCCAGCCACGTGGCGCTGGTATCGCTCCTTCTCAGATCGGAAGGATTCGAACACTACAGATGTGATCGTAACTTATCCATGGGTATGAACCTTAGCAACATGTCTAAGATGCTCAAGTGCGCCGGTAATGACGACAT...

Protein

Download Protein FASTA

264 aa · TkA08G044660|TK1151|PROTEIN

MLELRLVQGSLLKKVMESIKDLVNDANFDCSATGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLSNMSKMLKCAGNDDIITLKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPEAEYHAIVRMPSSEFARICKDLSSIGDTVVISVTKEGVKFSTRGDIGTANVVCRQNTTVDKPEEATVIEMNEPVSLTFALRYMNSFTKATPLSSTVTISLSSELPVVVEYKIAEMGYLRFYLAPKIEEDEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G044660`
TK1151 ID	TkA08G044660
OH-1004 ID	LXL04_000604
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	89.700
Protein coverage (%)	TK1151 100.000 / OH-1004 98.639 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G044660

Location Chr08:11396024-11397450 (+)

Description Similar to PCNA: Proliferating cell nuclear antigen

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07370`	Confers DNA tethering and processivity to DNA polymerases and other proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000604 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006272 leading strand elongation Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006298 mismatch repair Biological Process

GO:0019985 translesion synthesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0043626 PCNA complex Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0030337 DNA polymerase processivity factor activity Molecular Function

KEGG gene cross-reference

bna:106420145

nta:107779602

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · TkA08G044660 · TK1151

Cytoplasm0.272

Rank 2 · TkA08G044660 · TK1151

Cell membrane0.022

Rank 3 · TkA08G044660 · TK1151

Mitochondrion0.018

Rank 4 · TkA08G044660 · TK1151

Lysosome / Vacuole0.013

Rank 5 · TkA08G044660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00705PCNA_N1-125 aa

PF04005Hus19-90 aa

PF04139Rad914-216 aa

PF30409HTH_ParB_Mtase19-41 aa

PF30409HTH_ParB_Mtase119-132 aa

PF02747PCNA_C127-254 aa

PF04005Hus1141-183 aa

PF00238Ribosomal_L14150-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G044660	`PF00705`	PCNA_N	1	125	1.9e-58	196.4
TkA08G044660	`PF04005`	Hus1	9	90	0.069	13.0
TkA08G044660	`PF04139`	Rad9	14	216	1.5e-06	28.6
TkA08G044660	`PF30409`	HTH_ParB_Mtase	19	41	0.1	13.9
TkA08G044660	`PF30409`	HTH_ParB_Mtase	119	132	0.1	13.9
TkA08G044660	`PF02747`	PCNA_C	127	254	2.7e-61	206.1
TkA08G044660	`PF04005`	Hus1	141	183	0.069	13.0
TkA08G044660	`PF00238`	Ribosomal_L14	150	194	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M7Q7`	Arabidopsis thaliana	sp\|Q9M7Q7\|PCNA1_ARATH DNA sliding clamp PCNA1	91.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card