TkA08G041090 | RubberDandelionOmics

Gene overview

TkA08G041090

Reference: TK1151 Chr: Chr08 Coordinates: 10465327-10473476 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

818 bp · TkA08G041090|TK1151|cDNA

TTCCGGGATGTACGAGGAGTTCTCTGCTTTGGCGCCATTGATGAACGACCTTCGCTTGCTCCGGCGGTCGTTCATCAATGGCGCCAAAGCAGAGAACTCTCCTCGTACATCCCGGAACCCAGATCTCATCAGGTGTCGGGAAATATACTCCCGCTCTCAGATGTACCACAAGAGAGGACTCTGGGCCATTAAAAGCCAAGAACGGTGGCACTTTCCCCACCCACGTGAAGAAGGCCGCCGACGCTCCGTCGCCGCCAAGC...

CDS

Download CDS FASTA

333 bp · TkA08G041090|TK1151|CDS

ATGGCGCCAAAGCAGAGAACTCTCCTCGTACATCCCGGAACCCAGATCTCATCAGGTGTCGGGAAATATACTCCCGCTCTCAGATGTACCACAAGAGAGGACTCTGGGCCATTAAAAGCCAAGAACGGTGGCACTTTCCCCACCCACGTGAAGAAGGCCGCCGACGCTCCGTCGCCGCCAAGCCCCCGAAGTTTTACCACCGCCGACGATGTCAAGAAACCCCTTGTCAACAAGCGCAAAGCCAGGCCCACTAAGCTCAG...

Protein

Download Protein FASTA

110 aa · TkA08G041090|TK1151|PROTEIN

MAPKQRTLLVHPGTQISSGVGKYTPALRCTTREDSGPLKAKNGGTFPTHVKKAADAPSPPSPRSFTTADDVKKPLVNKRKARPTKLRASITPGTVLIILAGGLRGSALCS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G041090`
TK1151 ID	TkA08G041090
OH-1004 ID	LXL04_017907
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.700
Protein coverage (%)	TK1151 95.455 / OH-1004 44.635 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G041090

Location Chr08:10465327-10473476 (-)

Description Similar to RPL6: 60S ribosomal protein L6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74050`	Large ribosomal subunit protein eL6x.	No verified direct reference in this release
`At1g74060`	Large ribosomal subunit protein eL6y.	No verified direct reference in this release
`At1g18540`	Large ribosomal subunit protein eL6z.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017907 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000027 ribosomal large subunit assembly Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0015934 large ribosomal subunit Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

KEGG gene cross-reference

ath:AT1G18540

ath:AT1G74050

ath:AT1G74060

ssc:733592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.393

Rank 1 · TkA08G041090 · TK1151

Nucleus0.372

Rank 2 · TkA08G041090 · TK1151

Mitochondrion0.190

Rank 3 · TkA08G041090 · TK1151

Cell membrane0.100

Rank 4 · TkA08G041090 · TK1151

Endoplasmic reticulum0.068

Rank 5 · TkA08G041090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9C5`	Arabidopsis thaliana	sp\|Q9C9C5\|RL63_ARATH Large ribosomal subunit protein eL6x	53.800%	Swiss-Prot	High
`Q9C9C6`	Arabidopsis thaliana	sp\|Q9C9C6\|RL62_ARATH Large ribosomal subunit protein eL6y	52.800%	Swiss-Prot	High
`Q9FZ76`	Arabidopsis thaliana	sp\|Q9FZ76\|RL61_ARATH Large ribosomal subunit protein eL6z	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card