TkA08G040950 | RubberDandelionOmics

Gene overview

TkA08G040950

Reference: TK1151 Chr: Chr08 Coordinates: 10430820-10433090 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1789 bp · TkA08G040950|TK1151|cDNA

TTTGTCTCAAACCCTGGCCTTTCAACCACCAAAAACAACCAACTCATTTCTTTCATAACCTTCCCGCCAAAACCACCATAGTTTCGTGTTCTTGAACGAGCTTCTGCAATGGCGGAATCATGCAGTTTGATGGTCTTGTTGACTCTCTTTACAAGCTTCTCGGTATGCGTAAACGCCAACTTTGATTACAAAGACGCCCTAAAGAAATCCATAATTTTCTTGGAAGCCCAAAGGTCCGGGAAGCTTCCGCCACATCATCG...

CDS

Download CDS FASTA

741 bp · TkA08G040950|TK1151|CDS

ATGGGCGGCGACATGGCTATATATTGCAACAAAGAGACCAATTTACATGAAATTTATACAAGAAGAGTCAACCACCGCCGTTGTTACCGAATTCAGCTGGGACTCAAATTCGCCGGTGCTCAAGTCCTTCTTTCTCAGTTATATTTTGAAGGAAGAAAGGACTTGCAAACGTTTAAACAACAAGCTGACGGATTCGTATGCAACAATCTTCCCGAAAGCCCTTACCGGCAAGTTTTCATGACTCCCGGAGGTCTGATTCA...

Protein

Download Protein FASTA

246 aa · TkA08G040950|TK1151|PROTEIN

MGGDMAIYCNKETNLHEIYTRRVNHRRCYRIQLGLKFAGAQVLLSQLYFEGRKDLQTFKQQADGFVCNNLPESPYRQVFMTPGGLIHLRDGANSQYVTATAFLFSVYSDLLARHKMEVTCGDKRFTCVQIMHFAKKQMDYLLGHNPVKRSMMVGFGKDPPVHAHHRGSSVPVDAGKKRSELWDDFVYWYNTDKPNPNELTGAILGGPDRADRFVDGRANSSMTEPCTYINSCAVGVLARLTRHHKR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G040950`
TK1151 ID	TkA08G040950
OH-1004 ID	LXL04_026248
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	43.100
Protein coverage (%)	TK1151 84.553 / OH-1004 43.093 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G040950

Location Chr08:10430820-10433090 (+)

Description Similar to CEL1: Endoglucanase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43860`	Endoglucanase 16.	No verified direct reference in this release
`At4g09740`	Endoglucanase 18.	No verified direct reference in this release
`At4g23560`	Endoglucanase 20.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0778600`	Endoglucanase 8.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026248 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007389 pattern specification process Biological Process

GO:0009624 response to nematode Biological Process

GO:0009835 fruit ripening Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02800

ath:AT4G02290

dosa:Os02g0123700

dosa:Os08g0114200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.694

Rank 1 · TkA08G040950 · TK1151

Cell membrane0.098

Rank 2 · TkA08G040950 · TK1151

Endoplasmic reticulum0.096

Rank 3 · TkA08G040950 · TK1151

Cytoplasm0.073

Rank 4 · TkA08G040950 · TK1151

Lysosome / Vacuole0.062

Rank 5 · TkA08G040950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06769YoeB_toxin13-30 aa

PF00759Glyco_hydro_931-237 aa

PF06769YoeB_toxin147-167 aa

PF06769YoeB_toxin179-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G040950	`PF06769`	YoeB_toxin	13	30	0.24	12.2
TkA08G040950	`PF00759`	Glyco_hydro_9	31	237	2.5e-46	159.6
TkA08G040950	`PF06769`	YoeB_toxin	147	167	0.24	12.2
TkA08G040950	`PF06769`	YoeB_toxin	179	193	0.24	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYG3`	Arabidopsis thaliana	sp\|Q8VYG3\|GUN16_ARATH Endoglucanase 16	64.100%	Swiss-Prot	High
`Q9SZ90`	Arabidopsis thaliana	sp\|Q9SZ90\|GUN18_ARATH Endoglucanase 18	44.200%	Swiss-Prot	Medium
`Q9SUS0`	Arabidopsis thaliana	sp\|Q9SUS0\|GUN20_ARATH Endoglucanase 20	44.700%	Swiss-Prot	Medium
`Q6K7G9`	Oryza sativa subsp. japonica	sp\|Q6K7G9\|GUN8_ORYSJ Endoglucanase 8	57.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card