LXL04_026248 | RubberDandelionOmics

Gene overview

LXL04_026248

Reference: OH-1004 Chr: Chr05 Coordinates: 123756877-123758658 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · LXL04_026248|LXL04_026248|OH1004|cDNA

ATGGCGCCTACATTGCTCATCATTTTCCTTCTATTGTCTTCTTCTTTCGCTTCTGCTTTCAATTCCGATCACTATTCCGATGCCCTCTCCAAATCCATCCTCTTCTTCGAAGGTCAAAGATCCGGCAAGTTACCTGCAAATCAACGTCTCAATTGGCGCGGTGATTCCGCCTTACGCGATGGTTCTTCCGCCAATGTCGATCTAGTCGGAGGTTATTACGATGCAGGTGATAATATGAAGTTTGGGCTTCCCATGGCGTT...

CDS

Download CDS FASTA

1458 bp · LXL04_026248|LXL04_026248|OH1004|CDS

ATGGCGCCTACATTGCTCATCATTTTCCTTCTATTGTCTTCTTCTTTCGCTTCTGCTTTCAATTCCGATCACTATTCCGATGCCCTCTCCAAATCCATCCTCTTCTTCGAAGGTCAAAGATCCGGCAAGTTACCTGCAAATCAACGTCTCAATTGGCGCGGTGATTCCGCCTTACGCGATGGTTCTTCCGCCAATGTCGATCTAGTCGGAGGTTATTACGATGCAGGTGATAATATGAAGTTTGGGCTTCCCATGGCGTT...

Protein

Download Protein FASTA

485 aa · LXL04_026248|LXL04_026248|OH1004|PROTEIN

MAPTLLIIFLLLSSSFASAFNSDHYSDALSKSILFFEGQRSGKLPANQRLNWRGDSALRDGSSANVDLVGGYYDAGDNMKFGLPMAFTTTMLAWSIIEFGGFMQSELGNAKDALRWGSDYLLKAATATPGTLYVQVGEANSDHQCWERPEDMDTSRGVYKVSAQNPGSDVASETAAALAAASIVFQDSDPSYSHTLLQTAMNVFKFADDYRGSYSDSLHNAVCPFYCSYSGYNDELLWGAAWIHRATQDARYMTYIESNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026248`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026248

Location Chr05:123756877-123758658 (-)

Description Similar to CEL1: Endoglucanase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02290`	Endoglucanase 17.	No verified direct reference in this release
`At1g02800`	Endoglucanase 1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0114200`	Endoglucanase 19.	No verified direct reference in this release
`Os02g0123700`	Endoglucanase 4.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026248 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007389 pattern specification process Biological Process

GO:0009624 response to nematode Biological Process

GO:0009835 fruit ripening Biological Process

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02800

ath:AT4G02290

dosa:Os02g0123700

dosa:Os08g0114200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.379

Rank 1 · LXL04_026248 · OH-1004

Cell membrane0.362

Rank 2 · LXL04_026248 · OH-1004

Lysosome / Vacuole0.141

Rank 3 · LXL04_026248 · OH-1004

Cytoplasm0.117

Rank 4 · LXL04_026248 · OH-1004

Endoplasmic reticulum0.094

Rank 5 · LXL04_026248 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759.26Glyco_hydro_925-478 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026248	`PF00759.26`	Glyco_hydro_9	25	478	3.9e-164	547.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81416`	Arabidopsis thaliana	Endoglucanase 17	63.913%	Swiss-Prot	strong database homology
`Q9SRX3`	Arabidopsis thaliana	Endoglucanase 1	62.118%	Swiss-Prot	strong database homology
`Q6YXT7`	Oryza sativa subsp. japonica	Endoglucanase 19	66.526%	Swiss-Prot	strong database homology
`Q6Z715`	Oryza sativa subsp. japonica	Endoglucanase 4	61.569%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card