TkA08G040940 | RubberDandelionOmics

Gene overview

TkA08G040940

Reference: TK1151 Chr: Chr08 Coordinates: 10423309-10425626 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · TkA08G040940|TK1151|cDNA

AAAAAAGCAAGATGTGAGATCGTCTTGTTCCTTATACCCCAAGAAGTTATTAGATTTCACAAATTCGATGTTGAAATTGTTGTGGAGAAGCAACTGAAATCATACATTAGACCAAATCAGAAACCGCAGTGGAAAATGGCGACAGTTGAGGCGGTTTTAGGTAATTTGACGGCGGGAGAACGCAATATTCTGACCGGGGTGAACACCGGAGCCTCTAGTCTATCGCTGTTAGGTTCTGGATTCATAGTGCTTTGCTACCT...

CDS

Download CDS FASTA

582 bp · TkA08G040940|TK1151|CDS

ATGACAGTTGTCAGATCTATCGGTAATGATCATGGACATGTAGGACACATAGGCCATGTGGCTGCATGGTGCTGGACAGAAACCGGACGAACAGGAAAGGCTGTTCACTTCTTTACATTCTATGCACCTCTTTGGGGGGCGATTCTTTTCAATGGGTTCACTTACTTTCAAGTTATACGCATGTTAAACAATGCAACCCGTATGGCAGTGGGGATGTCAGATCGAGGGTCTCAGTCAGATACACGTGCAGATATGAAGGC...

Protein

Download Protein FASTA

193 aa · TkA08G040940|TK1151|PROTEIN

MTVVRSIGNDHGHVGHIGHVAAWCWTETGRTGKAVHFFTFYAPLWGAILFNGFTYFQVIRMLNNATRMAVGMSDRGSQSDTRADMKALNRWGYYPLILIGSWSFGTVNRIHDFIEPDHKIFWLSVLDVGMASLMGLFNSIAWIKLVSTKGNFERLDLLPEGLRRWFPKKLKSRSQQQQHDSELVSLRTEDQDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G040940`
TK1151 ID	TkA08G040940
OH-1004 ID	LXL04_017910
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.300
Protein coverage (%)	TK1151 100.000 / OH-1004 56.891 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G040940

Location Chr08:10423309-10425626 (-)

Description Similar to GCR1: G-protein coupled receptor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g48270`	Together with GPA1, may regulate the cell cycle via a signaling cascade that uses phosphatidylinositol-specific phospholipase C (PI-PLC) as an effector and inositol 1,4,5-trisphosphate(IP(3)) as a second messenger.	GCR1, the putative Arabidopsis G protein-coupled receptor gene is cell cycle-regulated, and its overexpression abolishes seed dormancy and shortens time to flowering.2002 · DOI: 10.1073/pnas.072087699 The G-protein-coupled receptor GCR1 regulates DNA synthesis through activation of phosphatidylinositol-specific phospholipase C.2003 · DOI: 10.1104/pp.103.026005 The Arabidopsis putative G protein-coupled receptor GCR1 interacts with the G protein alpha subunit GPA1 and regulates abscisic acid signaling.2004 · DOI: 10.1105/tpc.020321 GCR1 can act independently of heterotrimeric G-protein in response to brassinosteroids and gibberellins in Arabidopsis seed germination.2004 · DOI: 10.1104/pp.104.038992 G-protein-coupled receptor 1, G-protein Galpha-subunit 1, and prephenate dehydratase 1 are required for blue light-induced production of phenylalanine in etiolated Arabidopsis.2006 · DOI: 10.1104/pp.105.071282 The GCR1, GPA1, PRN1, NF-Y signal chain mediates both blue light and abscisic acid responses in Arabidopsis.2007 · DOI: 10.1104/pp.106.089904 A higher plant seven-transmembrane receptor that influences sensitivity to cytokinins.1998 · DOI: 10.1016/s0960-9822(98)70131-9

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017910 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006571 L-tyrosine biosynthetic process Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0007165 signal transduction Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0007186 G protein-coupled receptor signaling pathway Biological Process

GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway Biological Process

GO:0009094 L-phenylalanine biosynthetic process Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT1G48270

ddi:DDB_G0277829

ddi:DDB_G0280983

ddi:DDB_G0286037

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.817

Rank 1 · TkA08G040940 · TK1151

Cytoplasm0.138

Rank 2 · TkA08G040940 · TK1151

Endoplasmic reticulum0.062

Rank 3 · TkA08G040940 · TK1151

Lysosome / Vacuole0.048

Rank 4 · TkA08G040940 · TK1151

Golgi apparatus0.043

Rank 5 · TkA08G040940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04714`	Arabidopsis thaliana	sp\|O04714\|GCR1_ARATH G protein-coupled receptor 1	67.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card