TkA08G038410 | RubberDandelionOmics

Gene overview

TkA08G038410

Reference: TK1151 Chr: Chr08 Coordinates: 9771313-9774367 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2305 bp · TkA08G038410|TK1151|cDNA

CTTAAATATGTAACTTCCATTTTAAATTGGTTATTTTATTGTCTAAGTTAGTAATATATAAGTTTAAGCTAAAATATTGTATTCTGAATAAAATATATAAAGTTATTAATCAAGAATTACACAAAATAGCTCATTTTTTGCACTTTACAAAATGAACACCCGAATCTGAAATGGGTGGTTTCGACCCAAGATCCGAAAACAAAACAGTAACTTACTTGGTGGGTTGCGCACTTGCGCTCGGTTATGGTCCACGTTCTACT...

CDS

Download CDS FASTA

1458 bp · TkA08G038410|TK1151|CDS

ATGACAGACCAAAGATCTACATATACACTAGATGAAGCACTTGTGGCCATCGGATTTGGAAAGTACCAAGGATGGATAATCGCTTACGCAGGTCTCGGTTCCATAGCTGAAGCAATGGAGGTGATGATCCTTTCCTTCATCGGACCATCAGTTAGGTCAGAATGGAACCTCTCATCCACCCAAGAAAGCCTAATAACAACCGTAGTTTTTGCTGGCATGCTTATCGGAGCTTATACATGGGGTGCCATCTCAGATAATTT...

Protein

Download Protein FASTA

485 aa · TkA08G038410|TK1151|PROTEIN

MTDQRSTYTLDEALVAIGFGKYQGWIIAYAGLGSIAEAMEVMILSFIGPSVRSEWNLSSTQESLITTVVFAGMLIGAYTWGAISDNFGRRKGLLSIAIVTSGASLLSAFSPNYISLVTLRCIGGIGLGGGPTYNSWFLEFVPVPSRGRWMVIFATFWTIGTIAEASLAWIIMPRFGWRWLLAISSLPAIFALVFYNFVPESPRYLCLKGQTTKAHNILKRAAIVNNKKLPSGTLLSDQITIDEELDTLESTDLLSPKRNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G038410`
TK1151 ID	TkA08G038410
OH-1004 ID	LXL04_017940
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 88.022 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G038410

Location Chr08:9771313-9774367 (+)

Description Similar to OCT7: Organic cation/carnitine transporter 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13050`	High affinity carnitine transporter involved in the active cellular uptake of carnitine.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017940 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0042908 xenobiotic transport Biological Process

GO:2001142 nicotinate transport Biological Process

GO:2001143 N-methylnicotinate transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009925 basal plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

GO:0090416 nicotinate transmembrane transporter activity Molecular Function

GO:0090417 N-methylnicotinate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G13050

cel:CELE_ZK637.1

hsa:55530

pon:100173685

xla:734235

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.506

Rank 1 · TkA08G038410 · TK1151

Cell membrane0.178

Rank 2 · TkA08G038410 · TK1151

Endoplasmic reticulum0.133

Rank 3 · TkA08G038410 · TK1151

Golgi apparatus0.108

Rank 4 · TkA08G038410 · TK1151

Cytoplasm0.099

Rank 5 · TkA08G038410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12832MFS_1_like24-45 aa

PF07690MFS_132-306 aa

PF00083Sugar_tr52-476 aa

PF12832MFS_1_like56-120 aa

PF12832MFS_1_like110-204 aa

PF12832MFS_1_like331-424 aa

PF07690MFS_1335-467 aa

PF12832MFS_1_like336-424 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G038410	`PF12832`	MFS_1_like	24	45	0.0003	20.7
TkA08G038410	`PF07690`	MFS_1	32	306	1.4e-36	126.8
TkA08G038410	`PF00083`	Sugar_tr	52	476	1.3e-37	130.5
TkA08G038410	`PF12832`	MFS_1_like	56	120	0.0003	20.7
TkA08G038410	`PF12832`	MFS_1_like	110	204	0.0003	20.7
TkA08G038410	`PF12832`	MFS_1_like	331	424	0.0003	20.7
TkA08G038410	`PF07690`	MFS_1	335	467	1.4e-36	126.8
TkA08G038410	`PF12832`	MFS_1_like	336	424	0.0003	20.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940M4`	Arabidopsis thaliana	sp\|Q940M4\|OCT7_ARATH Organic cation/carnitine transporter 7	57.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card