TkA08G037840 | RubberDandelionOmics

Gene overview

TkA08G037840

Reference: TK1151 Chr: Chr08 Coordinates: 9653441-9655847 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1843 bp · TkA08G037840|TK1151|cDNA

AAAAAAAAAAAACAAGTACACATACGCATGATTTTTGATATACAGATCCCTCTTTGTCAAACCCCTCCTTCATAAAAACCCTAGGTCGCACAAACGCACACTCATGGCTTCCACCATACCCTCAGGCAATGGCACCGTCGCGGTAGCATTAAAATCGGAGACAGAATCTGCGACTACTGCCATCGCCGTCTCAGAAGCGGCTCTTGGCACCGAGATGGAGCCGCCGGGTAAAAATCCCCTGGCTACCGATTCCGCTCTAT...

CDS

Download CDS FASTA

1437 bp · TkA08G037840|TK1151|CDS

ATGGCTTCCACCATACCCTCAGGCAATGGCACCGTCGCGGTAGCATTAAAATCGGAGACAGAATCTGCGACTACTGCCATCGCCGTCTCAGAAGCGGCTCTTGGCACCGAGATGGAGCCGCCGGGTAAAAATCCCCTGGCTACCGATTCCGCTCTATCGGAGGAGAAGAAGTGGCCTGGATGGCCTGGGGACTGCGTTTTCCGACTCATTGTGCCGGTGCTTAAAGTCGGGAGTATAATTGGCCGGAAAGGAGATATAAT...

Protein

Download Protein FASTA

478 aa · TkA08G037840|TK1151|PROTEIN

MASTIPSGNGTVAVALKSETESATTAIAVSEAALGTEMEPPGKNPLATDSALSEEKKWPGWPGDCVFRLIVPVLKVGSIIGRKGDIIRKMCEDTKARIRVLDAPVGTPDRIVLISGKEETDAPLSPAMDAVIRVFKRINGFPENEGESIASVPFCSIRLLVPSMQAISLIGKQGSTIKSVQESTGCQVRVLSGDDVAAISANSEERIVDMQGEAIKVLKALEAVVGHLRRFLVDRSVLPLFEKTNNVSTPTQEPQVETWA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G037840`
TK1151 ID	TkA08G037840
OH-1004 ID	LXL04_017958
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 91.423 / OH-1004 91.232 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G037840

Location Chr08:9653441-9655847 (-)

Description Similar to PEP: RNA-binding KH domain-containing protein PEPPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26000`	Regulates vegetative and gynoecium development.	No verified direct reference in this release
`At3g04610`	Positively regulates flowering by repressing FLC expression and post-transcriptional modification.	No verified direct reference in this release
`At5g64390`	Functions in floral reproductive organ identity in the third whorl and floral determinacy specification by specifically promoting the processing of AGAMOUS (AG) pre-mRNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017958 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006396 RNA processing Biological Process

GO:0009299 mRNA transcription Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0048367 shoot system development Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048577 negative regulation of short-day photoperiodism, flowering Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G04610

ath:AT4G18375

ath:AT4G26000

mmu:59093

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.889

Rank 1 · TkA08G037840 · TK1151

Cytoplasm0.219

Rank 2 · TkA08G037840 · TK1151

Cell membrane0.029

Rank 3 · TkA08G037840 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA08G037840 · TK1151

Lysosome / Vacuole0.013

Rank 5 · TkA08G037840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00013KH_167-119 aa

PF13083KH_KhpA-B71-88 aa

PF07650KH_275-102 aa

PF16005MOEP1975-95 aa

PF13184KH_NusA_1st75-101 aa

PF22675KH-I_KHDC4-BBP76-101 aa

PF22891KH_PNO1_2nd76-105 aa

PF24668KH_Vigilin85-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G037840	`PF00013`	KH_1	67	119	2.3e-39	133.7
TkA08G037840	`PF13083`	KH_KhpA-B	71	88	0.006	17.2
TkA08G037840	`PF07650`	KH_2	75	102	4.4e-06	27.1
TkA08G037840	`PF16005`	MOEP19	75	95	0.12	13.1
TkA08G037840	`PF13184`	KH_NusA_1st	75	101	0.25	12.3
TkA08G037840	`PF22675`	KH-I_KHDC4-BBP	76	101	2e-08	34.7
TkA08G037840	`PF22891`	KH_PNO1_2nd	76	105	0.02	15.5
TkA08G037840	`PF24668`	KH_Vigilin	85	119	0.27	11.8
TkA08G037840	`PF00013`	KH_1	157	224	2.3e-39	133.7
TkA08G037840	`PF16005`	MOEP19	161	181	0.12	13.1
TkA08G037840	`PF07650`	KH_2	164	196	4.4e-06	27.1
TkA08G037840	`PF22675`	KH-I_KHDC4-BBP	169	190	2e-08	34.7
TkA08G037840	`PF13083`	KH_KhpA-B	169	181	0.006	17.2
TkA08G037840	`PF21800`	KH_KRR1_2nd	169	199	0.012	16.3
TkA08G037840	`PF22891`	KH_PNO1_2nd	169	199	0.02	15.5
TkA08G037840	`PF13184`	KH_NusA_1st	169	190	0.25	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZH4`	Arabidopsis thaliana	sp\|Q9SZH4\|PEP_ARATH RNA-binding KH domain-containing protein PEPPER	57.400%	Swiss-Prot	High
`Q9SR13`	Arabidopsis thaliana	sp\|Q9SR13\|FLK_ARATH Flowering locus K homology domain	45.000%	Swiss-Prot	Medium
`F4KDN0`	Arabidopsis thaliana	sp\|F4KDN0\|HEN4_ARATH KH domain-containing protein HEN4	29.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card