TkA08G035880 | RubberDandelionOmics

Gene overview

TkA08G035880

Reference: TK1151 Chr: Chr08 Coordinates: 9153701-9156413 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1922 bp · TkA08G035880|TK1151|cDNA

TACATACATCCCCACACTTGCATTTAACAAATTTCTTGATCTTTCCGCACGATTATCTTAAGATTACGGAATATGTAGACGAAGAAGACATCGTGCAGGGATTCTCGGAAGACTGAATATGTAAATTAACGAACAAGGTGTAAAAGAGGAGGAAACGAAAAACGTGACTTGTAGATAATGATCCACACACGTCCACTTAGACAAGGTTACCATGTACAAGGGTCTTCACCTGGGATTTGATGATTTTGACATTTTTAAGA...

CDS

Download CDS FASTA

1191 bp · TkA08G035880|TK1151|CDS

ATGATGCTGATTCAACAATTCAAGTCACCCCCTTCTTGCAATTTCTCAAATTTCACCTCAAATTCGACACCCCCTTCCCAAAATCACAACAATGTGCGTTTTTCAATCAAGAACCACAACAACAGCAGCAGTAGCGTCTCTTCTACTGATTCCACTCCGATCACTCCGATGAACAACCACCTTAATGACGAATCTTCAAATTCAGCATCGGTAATGTCGTCATCTGCTTCGTCCAAATCGCCGCCGTATCCTGGTGGTAT...

Protein

Download Protein FASTA

396 aa · TkA08G035880|TK1151|PROTEIN

MMLIQQFKSPPSCNFSNFTSNSTPPSQNHNNVRFSIKNHNNSSSSVSSTDSTPITPMNNHLNDESSNSASVMSSSASSKSPPYPGGMGPYTGRDPNVKKPSWLRQKAPQGEKYQEVKTSLKRLKLNTVCEEAQCPNIGECWNGGEDGIATATIMLLGDTCTRGCRFCAVKTSKNPAPPDPMEPQNTAEAIASFGVDYIVLTSVDRDDLPDGGSGHFTETVKAMKKFKPEIMVECLTSDFRGDLEAVSMLANSGLDVFAHN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G035880`
TK1151 ID	TkA08G035880
OH-1004 ID	LXL04_017974
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G035880

Location Chr08:9153701-9156413 (+)

Description Similar to LIP1P: Lipoyl synthase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08415`	Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives (By similarity).	The biosynthetic pathway for lipoic acid is present in plastids and mitochondria in Arabidopsis thaliana.2002 · DOI: 10.1016/s0014-5793(02)02589-9 Two redundant octanoyltransferases and one obligatory lipoyl synthase provide protein-lipoylation autonomy to plastids of Arabidopsis.2014 · DOI: 10.1111/plb.12028

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AA76`	Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017974 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009107 lipoate biosynthetic process Biological Process

GO:0009249 protein lipoylation Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016992 lipoate synthase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT5G08415

pop:18108579

rcu:8279195

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.929

Rank 1 · TkA08G035880 · TK1151

Mitochondrion0.090

Rank 2 · TkA08G035880 · TK1151

Nucleus0.034

Rank 3 · TkA08G035880 · TK1151

Cytoplasm0.027

Rank 4 · TkA08G035880 · TK1151

Cell membrane0.012

Rank 5 · TkA08G035880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16881LIAS_N14-42 aa

PF16881LIAS_N97-134 aa

PF04055Radical_SAM156-318 aa

PF16881LIAS_N293-320 aa

PF04055Radical_SAM338-359 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G035880	`PF16881`	LIAS_N	14	42	2.2e-10	41.6
TkA08G035880	`PF16881`	LIAS_N	97	134	2.2e-10	41.6
TkA08G035880	`PF04055`	Radical_SAM	156	318	3.8e-25	89.7
TkA08G035880	`PF16881`	LIAS_N	293	320	2.2e-10	41.6
TkA08G035880	`PF04055`	Radical_SAM	338	359	3.8e-25	89.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEE8`	Arabidopsis thaliana	sp\|Q8LEE8\|LISC_ARATH Lipoyl synthase, chloroplastic	85.800%	Swiss-Prot	High
`B8AA76`	Oryza sativa subsp. indica	sp\|B8AA76\|LISC1_ORYSI Lipoyl synthase 1, chloroplastic	78.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card