TkA08G034780 | RubberDandelionOmics

Gene overview

TkA08G034780

Reference: TK1151 Chr: Chr08 Coordinates: 8884587-8886391 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1535 bp · TkA08G034780|TK1151|cDNA

GCAACCTCGTTCTCTCCGCTCATCTTCCTTGGTTCCAACACCACAACATTTGCAACAAAACAAAAACACCATCTTCCTTCTATTTATTCACATTCTTCATTTCAATTCACAACAAGAAACAAAGATTTTGCTTAGCCGAAAATGGCTTTCGCCGGAATCAAAGTTATCCAGCCCCTCGCTCTCCACGCCAGTAGCTCCGATCCCTACAATAGGGCAGCTAAGTCCATCGCCACTCCATCCCCCTTCCTTGGATCAACCCG...

CDS

Download CDS FASTA

1293 bp · TkA08G034780|TK1151|CDS

ATGGCTTTCGCCGGAATCAAAGTTATCCAGCCCCTCGCTCTCCACGCCAGTAGCTCCGATCCCTACAATAGGGCAGCTAAGTCCATCGCCACTCCATCCCCCTTCCTTGGATCAACCCGGACTCTCCGAATCAACCAATCCTTGCCAATTGCTCTATCTCGACCTGCTTCCTCTATCGTTGCTGCGGTGTCCGATGTTTTCAAGGAAAAGAAGCTCAAATCCACTTCGGATCTCTTGCTCACGAAAGAAGAAGGTTTAGA...

Protein

Download Protein FASTA

430 aa · TkA08G034780|TK1151|PROTEIN

MAFAGIKVIQPLALHASSSDPYNRAAKSIATPSPFLGSTRTLRINQSLPIALSRPASSIVAAVSDVFKEKKLKSTSDLLLTKEEGLEVYEDMILGRAFEDMCAQMYYRGKMFGFVHLYNGQEAVSSGFIKLLKKEDSVVSTYRDHVHALSKGVPARAVMSELFGKKTGCCRGQGGSMHMFSAEHNVLGGFAFIGEGIPVATGAAFSSKYRREVLKQADCDHVTLAFFGDGTCNNGQFFECLNMAALWKLPIIFVVENNLW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G034780`
TK1151 ID	TkA08G034780
OH-1004 ID	LXL04_017991
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 96.197 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G034780

Location Chr08:8884587-8886391 (-)

Description Similar to PDH-E1 ALPHA: Pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01090`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0119400`	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017991 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006086 pyruvate decarboxylation to acetyl-CoA Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0045254 pyruvate dehydrogenase complex Cellular Component

GO:0004739 pyruvate dehydrogenase (acetyl-transferring) activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G01090

dosa:Os04g0119400

rco:RC0347

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.954

Rank 1 · TkA08G034780 · TK1151

Mitochondrion0.081

Rank 2 · TkA08G034780 · TK1151

Cytoplasm0.023

Rank 3 · TkA08G034780 · TK1151

Peroxisome0.015

Rank 4 · TkA08G034780 · TK1151

Nucleus0.012

Rank 5 · TkA08G034780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00676E1_dh91-392 aa

PF02775TPP_enzyme_C168-319 aa

PF00456Transketolase_N193-321 aa

PF13292DXP_synthase_N218-262 aa

PF19645DUF6148344-386 aa

PF13292DXP_synthase_N352-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G034780	`PF00676`	E1_dh	91	392	2.2e-83	280.4
TkA08G034780	`PF02775`	TPP_enzyme_C	168	319	2.2e-05	25.0
TkA08G034780	`PF00456`	Transketolase_N	193	321	0.00076	19.3
TkA08G034780	`PF13292`	DXP_synthase_N	218	262	0.045	13.8
TkA08G034780	`PF19645`	DUF6148	344	386	0.085	13.7
TkA08G034780	`PF13292`	DXP_synthase_N	352	380	0.045	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O24457`	Arabidopsis thaliana	sp\|O24457\|ODPA3_ARATH Pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic	81.300%	Swiss-Prot	High
`Q7XTJ3`	Oryza sativa subsp. japonica	sp\|Q7XTJ3\|ODPA3_ORYSJ Pyruvate dehydrogenase E1 component subunit alpha-3, chloroplastic	81.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card