RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G028610
Reference: TK1151 Chr: Chr08 Coordinates: 7342059-7351251 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1162 bp · TkA08G028610|TK1151|cDNA

ATTCAACCATTTCTTAGTTATTTCACATTTTCATGTTGGCCCATATTGCATGTTTTCTTGTCTATATAGCCTCAATTTATTTACTTCATTTTGTTCACAACCCCTAAAGTGCTCATTTGTGTCTCTCTCCTTCTTGATTCGTTCTAGTGGTCCTAATCCGTGGTAGTGAAGGAAACCTCTGTCACGCATGTTCTTCCTGAACTTACACAATAACTGTTCACCATTTTAGCCACTACAAAGAAAAATGCTTCACTATATAG...

CDS

Download CDS FASTA

1893 bp · TkA08G028610|TK1151|CDS

ATGGTGAAGACTGCTCCTCTATCAACATGGCCTTGGGAAAATCTTGGCATTTTCAAGTATATGTTGCTTGGACCATTGGTGGGAAAGGTTATGCATTCAAGACTTGAAGGGGATGATAATCTAGCAAGCAATTGGTGTTTTCAAGTTCTCCTGATAAGCTTGATTAGATTTAATATATACATGTGGTATACCAACACATGTAACATGCTTTTCCTCACCCGAAACCGTCGGATTTTTACAAAAGGCGTTGACTTTAATCA...

Protein

Download Protein FASTA

630 aa · TkA08G028610|TK1151|PROTEIN

MVKTAPLSTWPWENLGIFKYMLLGPLVGKVMHSRLEGDDNLASNWCFQVLLISLIRFNIYMWYTNTCNMLFLTRNRRIFTKGVDFNQIDKEWDWDNFLILQALIASLAILLFPNGFANMPVWEAKGFVAVLVLHVLVSEPLYYWMHRLLHGNYLHAPYHSFHHLSAVPQPVTAGSTTFLEGLLVTTVIGLPLFGCCMFGFGSKTVIYSYVFVFDFLCCFGHSNVEIMPHRIFGKFPFFKYLLYTPTYYSLHHSEKSTNYC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G028610
TK1151 IDTkA08G028610
OH-1004 IDLXL04_018081
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.400
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G028610
LocationChr08:7342059-7351251 (+)
DescriptionSimilar to CER3: Very-long-chain aldehyde decarbonylase CER3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g57800 Involved in cuticule membrane and wax production, and in the typhine and sporopollenin biosynthesis of pollen.
Cloning and characterization of the WAX2 gene of Arabidopsis involved in cuticle membrane and wax production.2003 · DOI: 10.1105/tpc.010926
A novel male-sterile mutant of Arabidopsis thaliana, faceless pollen-1, produces pollen with a smooth surface and an acetolysis-sensitive exine.2003 · DOI: 10.1023/b:plan.0000009269.97773.70

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0653000 Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes. No verified direct reference in this release
UniProt: A2Z1F5 Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes. No verified direct reference in this release
Os09g0426800 Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes. No verified direct reference in this release
Os02g0178800 Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.
Characterization of Glossy1-homologous genes in rice involved in leaf wax accumulation and drought resistance.2009 · DOI: 10.1007/s11103-009-9483-0
UniProt: B8AIW3 Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018081 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0008610 lipid biosynthetic process Biological Process
GO:0009409 response to cold Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009611 response to wounding Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0010025 wax biosynthetic process Biological Process
GO:0010143 cutin biosynthetic process Biological Process
GO:0043447 alkane biosynthetic process Biological Process
GO:0046184 aldehyde biosynthetic process Biological Process
GO:0048235 pollen sperm cell differentiation Biological Process
GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference
ath:AT5G57800
dosa:Os02g0178800
dosa:Os06g0653000
dosa:Os09g0426800
osa:4328496
osa:4341702
osa:4347115
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.602
Rank 1 · TkA08G028610 · TK1151
Mitochondrion0.201
Rank 2 · TkA08G028610 · TK1151
Cytoplasm0.086
Rank 3 · TkA08G028610 · TK1151
Nucleus0.081
Rank 4 · TkA08G028610 · TK1151
Cell membrane0.054
Rank 5 · TkA08G028610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116FA_hydroxylase132-272 aa
PF08196UL2316-346 aa
PF04116FA_hydroxylase328-348 aa
PF12076CER1-like_C454-624 aa
PF00106adh_short454-504 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G028610PF04116FA_hydroxylase1322722.7e-1764.2
TkA08G028610PF08196UL23163460.07413.7
TkA08G028610PF04116FA_hydroxylase3283482.7e-1764.2
TkA08G028610PF12076CER1-like_C4546242.5e-67226.5
TkA08G028610PF00106adh_short4545040.07913.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8H1Z0Arabidopsis thalianasp|Q8H1Z0|CER3_ARATH Very-long-chain aldehyde decarbonylase CER364.600%Swiss-ProtHigh
Q67WQ7Oryza sativa subsp. japonicasp|Q67WQ7|GLO13_ORYSJ Very-long-chain aldehyde decarbonylase GL1-362.100%Swiss-ProtHigh
A2Z1F5Oryza sativa subsp. indicasp|A2Z1F5|GLO11_ORYSI Very-long-chain aldehyde decarbonylase GL1-159.000%Swiss-ProtHigh
Q69PA8Oryza sativa subsp. japonicasp|Q69PA8|GLO11_ORYSJ Very-long-chain aldehyde decarbonylase GL1-159.000%Swiss-ProtHigh
Q6ETL8Oryza sativa subsp. japonicasp|Q6ETL8|GLO12_ORYSJ Very-long-chain aldehyde decarbonylase GL1-260.400%Swiss-ProtHigh
B8AIW3Oryza sativa subsp. indicasp|B8AIW3|GLO12_ORYSI Very-long-chain aldehyde decarbonylase GL1-242.200%Swiss-ProtMedium

JBrowse

View in Genome Browser