TkA08G026900 | RubberDandelionOmics

Gene overview

TkA08G026900

Reference: TK1151 Chr: Chr08 Coordinates: 6962872-6964410 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1506 bp · TkA08G026900|TK1151|cDNA

ATGGAGACGACGTCTCTCCAACCTCCGATTTTAATCTTCCTAATCCTTCTGTTAACCTACGGCTTCTTCTTTCTCCGCCGTAAAAAACCCAAAACCACAGGCTTCAAAAACTACCCATTACTAGGAACTGTACCGGAATTTATCCGGAATCGCCACCGGTTCCTCGAATGGACCACCCAAGTCCTCTCCGATTCTCCGACCAACACCGCTCTTCTCTTCCGGTTCACCGAAATCAAGGGCTTCATCACCGCCAACCCTGC...

CDS

Download CDS FASTA

1506 bp · TkA08G026900|TK1151|CDS

ATGGAGACGACGTCTCTCCAACCTCCGATTTTAATCTTCCTAATCCTTCTGTTAACCTACGGCTTCTTCTTTCTCCGCCGTAAAAAACCCAAAACCACAGGCTTCAAAAACTACCCATTACTAGGAACTGTACCGGAATTTATCCGGAATCGCCACCGGTTCCTCGAATGGACCACCCAAGTCCTCTCCGATTCTCCGACCAACACCGCTCTTCTCTTCCGGTTCACCGAAATCAAGGGCTTCATCACCGCCAACCCTGC...

Protein

Download Protein FASTA

501 aa · TkA08G026900|TK1151|PROTEIN

METTSLQPPILIFLILLLTYGFFFLRRKKPKTTGFKNYPLLGTVPEFIRNRHRFLEWTTQVLSDSPTNTALLFRFTEIKGFITANPANVEHMIKTNFENYPKGTRFISILEDFLGRGIFNAEGETWKAQRKTASYEFNTRSLRNFVMETAMVELTTQFVPILERAADLNRVIDLQDLLERYAFDNICRVAFNVDPCCLAGDGTSGSEFMEAFEEASTLSCRRFFSVYPEFYKIKKLLNFGSELKLKKSIITVHKFAGDII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G026900`
TK1151 ID	TkA08G026900
OH-1004 ID	LXL04_018097
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G026900

Location Chr08:6962872-6964410 (-)

Description Similar to CYP94A1: Cytochrome P450 94A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63450`	Hydroxylase involved in the oxidation of the plant hormone jasmonoyl-L-isoleucine (JA-Ile), a bioactive phytohormone of the jasmonate-mediated signaling pathway.	Endoplasmic reticulum-associated inactivation of the hormone jasmonoyl-L-isoleucine by multiple members of the cytochrome P450 94 family in Arabidopsis.2014 · DOI: 10.1074/jbc.m114.603084

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018097 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002213 defense response to insect Biological Process

GO:0006694 steroid biosynthetic process Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009611 response to wounding Biological Process

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0010154 fruit development Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0048480 stigma development Biological Process

GO:0048653 anther development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ag:AAD10204

ag:AAG33645

ath:AT3G48520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.922

Rank 1 · TkA08G026900 · TK1151

Cytoplasm0.042

Rank 2 · TkA08G026900 · TK1151

Golgi apparatus0.041

Rank 3 · TkA08G026900 · TK1151

Cell membrane0.039

Rank 4 · TkA08G026900 · TK1151

Nucleus0.032

Rank 5 · TkA08G026900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45036-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G026900	`PF00067`	p450	36	476	4.7e-65	220.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMV7`	Arabidopsis thaliana	sp\|Q9FMV7\|C94B1_ARATH Cytochrome P450 94B1	44.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card