TkA08G022980 | RubberDandelionOmics

Gene overview

TkA08G022980

Reference: TK1151 Chr: Chr08 Coordinates: 5815206-5819452 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2916 bp · TkA08G022980|TK1151|cDNA

AAGCAAAAAGAGGGAAAGCACACACCATTGCACCTACACCACGTCACACAGAATTACAACCTTGGCGAAACCCAAGTACCCAACCCATCGTCTCAATATTGGTCCGACGAAAAACCCGACGGAAAACCGACGAGACCTAAATAACAATCCATCGGATTCCTGCGTCCTTTGATCGATCAACGATGGCCGGAGGGAGTAATAAGAAAAAAATCAATAAATCGAAAACTCGAAAACCCACCAAACAATCTTTGTTCGTGGAG...

CDS

Download CDS FASTA

2214 bp · TkA08G022980|TK1151|CDS

ATGGCCGGAGGGAGTAATAAGAAAAAAATCAATAAATCGAAAACTCGAAAACCCACCAAACAATCTTTGTTCGTGGAGGGTGGTTTGTTATCTGATTGGTCCCCTATCATCACTTCTCCTCCTTCCAGAGGAAAGAGTACTCATCCAATCGGTTCTGGGAATAAATTTAATGCATCTAAGAACAAATCTGCGGTGAAATATGAGATTGGTAGTACTTCTGGGGGTAAATCAAAAGCTACTCCCTCTACTTCGAGGATAGT...

Protein

Download Protein FASTA

737 aa · TkA08G022980|TK1151|PROTEIN

MAGGSNKKKINKSKTRKPTKQSLFVEGGLLSDWSPIITSPPSRGKSTHPIGSGNKFNASKNKSAVKYEIGSTSGGKSKATPSTSRIVDSRKPKANAFAYKYPQASSFTEEGGDGHNKFDKSNPIVLLDSKESKIIAYMDETPVSDSQTVKYTYDYGASFEVDDNDSPHIGLGFHDEEAEENPSFIEPSPVIEKQECSRFDSSSSHEMETDMMDDDGDGDDDSSSSPVTNSGFLSIGGMKLYTHDISDYEDDDNDDDDESL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G022980`
TK1151 ID	TkA08G022980
OH-1004 ID	LXL04_018163
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G022980`
Location	Chr08:5815206-5819452 (+)
Description	Similar to v1g244155: Zinc finger CCCH-type with G patch domain-containing protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018163` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0000390 spliceosomal complex disassembly Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0016607 nuclear speck Cellular Component GO:0031981 nuclear lumen Cellular Component GO:0071008 U2-type post-mRNA release spliceosomal complex Cellular Component GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function
KEGG gene cross-reference	ath:AT1G17070 hsa:55105 mmu:67769 nve:5510508 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.801

Rank 1 · TkA08G022980 · TK1151

Cytoplasm0.251

Rank 2 · TkA08G022980 · TK1151

Cell membrane0.078

Rank 3 · TkA08G022980 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA08G022980 · TK1151

Plastid0.019

Rank 5 · TkA08G022980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01424R3H433-491 aa

PF01585G-patch605-649 aa

PF12656G-patch_2607-650 aa

PF01585G-patch692-736 aa

PF12656G-patch_2694-736 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G022980	`PF01424`	R3H	433	491	1.4e-07	32.1
TkA08G022980	`PF01585`	G-patch	605	649	1.5e-30	105.5
TkA08G022980	`PF12656`	G-patch_2	607	650	6.3e-15	55.7
TkA08G022980	`PF01585`	G-patch	692	736	1.5e-30	105.5
TkA08G022980	`PF12656`	G-patch_2	694	736	6.3e-15	55.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card