TkA08G020950 | RubberDandelionOmics

Gene overview

TkA08G020950

Reference: TK1151 Chr: Chr08 Coordinates: 5244437-5245986 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · TkA08G020950|TK1151|cDNA

ATGACATCAACTAAGGGAGACAAACTGATACTAAGGGGACTAATGTTTCATGGGTATCATGGGGTCTATCAAGAGGAAAAGAAACTTGGTCAAAAGTTCTTAATCGATATAGATGCTTGGATGGATCTTCGGGCACCCGATCAGTCTGACAACATGGCTGATACAGTCAGTTATACAGACATCTATCGCATTGCAAAACATATAGTGGAGGGACCTTCTCAGAACCTTCTAGAATCAGTGGCTCAACTGATTGCAACAAC...

CDS

Download CDS FASTA

531 bp · TkA08G020950|TK1151|CDS

ATGACATCAACTAAGGGAGACAAACTGATACTAAGGGGACTAATGTTTCATGGGTATCATGGGGTCTATCAAGAGGAAAAGAAACTTGGTCAAAAGTTCTTAATCGATATAGATGCTTGGATGGATCTTCGGGCACCCGATCAGTCTGACAACATGGCTGATACAGTCAGTTATACAGACATCTATCGCATTGCAAAACATATAGTGGAGGGACCTTCTCAGAACCTTCTAGAATCAGTGGCTCAACTGATTGCAACAAC...

Protein

Download Protein FASTA

176 aa · TkA08G020950|TK1151|PROTEIN

MTSTKGDKLILRGLMFHGYHGVYQEEKKLGQKFLIDIDAWMDLRAPDQSDNMADTVSYTDIYRIAKHIVEGPSQNLLESVAQLIATTTLNNHSQISAVRVVVGKPHVAVPGPLDYLDPIPSCQRCDSLSPILIVTPCDNNSQFHADGYDMYHDILHASIPSHLDKSSIKDIDDSLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G020950`
TK1151 ID	TkA08G020950
OH-1004 ID	LXL04_004844
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 65.909 / OH-1004 89.231 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G020950

Location Chr08:5244437-5245986 (-)

Description Similar to FOLB1: Dihydroneopterin aldolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g11750`	Catalyzes the conversion of 7,8-dihydroneopterin into 6- hydroxymethyl-7,8-dihydropterin, a biosynthetic precursor of the vitamin tetrahydrofolate.	Folate biosynthesis in higher plants. cDNA cloning, heterologous expression, and characterization of dihydroneopterin aldolases.2004 · DOI: 10.1104/pp.103.038430
`At5g62980`	Catalyzes the conversion of 7,8-dihydroneopterin into 6- hydroxymethyl-7,8-dihydropterin, a biosynthetic precursor of the vitamin tetrahydrofolate.	Folate biosynthesis in higher plants. cDNA cloning, heterologous expression, and characterization of dihydroneopterin aldolases.2004 · DOI: 10.1104/pp.103.038430
`At3g21730`	Catalyzes the conversion of 7,8-dihydroneopterin into 6-hydroxymethyl-7,8-dihydropterin, a biosynthetic precursor of the vitamin tetrahydrofolate.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004844 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0046656 folic acid biosynthetic process Biological Process

GO:0140964 intracellular auxin homeostasis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004150 dihydroneopterin aldolase activity Molecular Function

GO:0016853 isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT3G11750

ath:AT3G21730

ath:AT5G62980

bsu:BSU00780

sep:SE_2268

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.445

Rank 1 · TkA08G020950 · TK1151

Nucleus0.223

Rank 2 · TkA08G020950 · TK1151

Mitochondrion0.174

Rank 3 · TkA08G020950 · TK1151

Peroxisome0.120

Rank 4 · TkA08G020950 · TK1151

Endoplasmic reticulum0.086

Rank 5 · TkA08G020950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02152FolB10-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G020950	`PF02152`	FolB	10	115	5e-31	108.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SF23`	Arabidopsis thaliana	sp\|Q9SF23\|FOLB1_ARATH Dihydroneopterin aldolase 1	56.500%	Swiss-Prot	Medium
`Q9FM54`	Arabidopsis thaliana	sp\|Q9FM54\|FOLB2_ARATH Dihydroneopterin aldolase 2	59.800%	Swiss-Prot	Medium
`Q6GKX5`	Arabidopsis thaliana	sp\|Q6GKX5\|FOLB3_ARATH Probable dihydroneopterin aldolase 3	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card