Gene Card
Gene overview
cDNA / CDS / Protein Sequences
759 bp · TkA08G020720|TK1151|cDNA
ATGAACTCAATTTGGATATGGAGATTAACTTGCATCACTACATTCCACATTCTCAAAAAAATTCATTTTATTCATTTCTCTAACCCCGCAAACGAAACAACATCGATTAATGGTTCATTCCATTATGATAGAATAACCAAACATAACAATGAAATGACGAGATATGATTTTGCAAGGGCTGGATTTGTAGGCACTTGTAAGAAACTTTTTCAAGAAGGACTCAAGGGCATATTTAGTTGGAATAAAGGAACCATTCTTAG...
759 bp · TkA08G020720|TK1151|CDS
ATGAACTCAATTTGGATATGGAGATTAACTTGCATCACTACATTCCACATTCTCAAAAAAATTCATTTTATTCATTTCTCTAACCCCGCAAACGAAACAACATCGATTAATGGTTCATTCCATTATGATAGAATAACCAAACATAACAATGAAATGACGAGATATGATTTTGCAAGGGCTGGATTTGTAGGCACTTGTAAGAAACTTTTTCAAGAAGGACTCAAGGGCATATTTAGTTGGAATAAAGGAACCATTCTTAG...
Protein
Download Protein FASTA252 aa · TkA08G020720|TK1151|PROTEIN
MNSIWIWRLTCITTFHILKKIHFIHFSNPANETTSINGSFHYDRITKHNNEMTRYDFARAGFVGTCKKLFQEGLKGIFSWNKGTILSGIAQSSIVFFAFDRYRYLIQNKYPSLMSDAMVDLIAGTSVGFISFALTYPIHLAETRLAHQGDHKYDIYKGRVHGMLKIHQEFGLKGLYQGIGPTVVAYSIFTGIKFLAFEGMKGNLPKEYNKVDTAILGCGVVTGIAAQIRLVENNRNPIYPPDLFQIRVIWTG
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G020720 |
|---|---|
| TK1151 ID | TkA08G020720 |
| OH-1004 ID | LXL04_017816 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 76.200 |
| Protein coverage (%) | TK1151 76.190 / OH-1004 74.477Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G020720 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:5188637-5189734 (+) | |||||||||
| Description | Similar to COAC2: Mitochondrial carrier protein CoAc2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0051503 adenine nucleotide transport Biological Process GO:1990559 mitochondrial coenzyme A transmembrane transport Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0005509 calcium ion binding Molecular Function GO:0015215 nucleotide transmembrane transporter activity Molecular Function GO:0015228 coenzyme A transmembrane transporter activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G14560 ath:AT4G26180 ddi:DDB_G0285599 zma:100191354 zma:100193242 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF09578Spore_YabQ6-20 aaPF00153Mito_carr62-109 aaPF09578Spore_YabQ93-145 aaPF00153Mito_carr118-206 aaPF09578Spore_YabQ216-225 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G020720 | PF09578 | Spore_YabQ | 6 | 20 | 0.044 | 14.7 |
| TkA08G020720 | PF00153 | Mito_carr | 62 | 109 | 7.1e-18 | 64.9 |
| TkA08G020720 | PF09578 | Spore_YabQ | 93 | 145 | 0.044 | 14.7 |
| TkA08G020720 | PF00153 | Mito_carr | 118 | 206 | 7.1e-18 | 64.9 |
| TkA08G020720 | PF09578 | Spore_YabQ | 216 | 225 | 0.044 | 14.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.