TkA08G020260 | RubberDandelionOmics

Gene overview

TkA08G020260

Reference: TK1151 Chr: Chr08 Coordinates: 5060477-5065400 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2694 bp · TkA08G020260|TK1151|cDNA

TGCCCTACCCGACTCGATCGCAAACATTCTCATGTGAAAACAAGTATTGGAACTACACAGCTCGAAGAACACACAGGCAGCTCTCCATACCCAGAGATTTGCTGCTTCTTCGTTTGTAATTTTAGAAATGGAGGAAAATATCAATAATGGAGTTGAAGAACAAGAATCCGCAAACCATGAACCGACGTCTGGACCTGTTCTCAATCCATCAATACCGTCCGGTGAGCAGACTGTTTGGGCCGACGTTGCCTCCCTTCTCG...

CDS

Download CDS FASTA

2211 bp · TkA08G020260|TK1151|CDS

ATGGAGGAAAATATCAATAATGGAGTTGAAGAACAAGAATCCGCAAACCATGAACCGACGTCTGGACCTGTTCTCAATCCATCAATACCGTCCGGTGAGCAGACTGTTTGGGCCGACGTTGCCTCCCTTCTCGATTCGGCTTGTAATGATCTTCAAGATGGAGAACTCATTCATGGAGAAAATTTTAATCTTTTCGCAGCCATGTCTGCTTTAGAGATAATGGACCCAAAGATGGATTCAGGCATTGTTTGTAGATACTA...

Protein

Download Protein FASTA

736 aa · TkA08G020260|TK1151|PROTEIN

MEENINNGVEEQESANHEPTSGPVLNPSIPSGEQTVWADVASLLDSACNDLQDGELIHGENFNLFAAMSALEIMDPKMDSGIVCRYYSVDEAIEDGAAPIPLSPNKTVDVHCMIDVMDHMLSCEATWHKGHSLAQTIFSCIYLLRPDRTSSHALLHSYCTVIRSTCNAVISAVSDSRTHEEEDLFTITSGLPLKRDGDEKCLSMLNVIDETVSRQLHACKSPSHKKRSVEDIEPLQTNLDLEEGYCKAVLCRLRFRKHFY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G020260`
TK1151 ID	TkA08G020260
OH-1004 ID	LXL04_018208
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 96.480 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G020260`
Location	Chr08:5060477-5065400 (-)
Description	Similar to Naa35: N-alpha-acetyltransferase 35, NatC auxiliary subunit
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018208` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008284 positive regulation of cell population proliferation Biological Process GO:0032006 regulation of TOR signaling Biological Process GO:0048659 smooth muscle cell proliferation Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0031417 NatC complex Cellular Component
KEGG gene cross-reference	dre:321587 mmu:78689 rno:64472 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.504

Rank 1 · TkA08G020260 · TK1151

Cytoplasm0.501

Rank 2 · TkA08G020260 · TK1151

Cell membrane0.057

Rank 3 · TkA08G020260 · TK1151

Mitochondrion0.047

Rank 4 · TkA08G020260 · TK1151

Golgi apparatus0.045

Rank 5 · TkA08G020260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04112Mak1054-195 aa

PF25789TPR_NAA35367-731 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G020260	`PF04112`	Mak10	54	195	1.1e-28	100.6
TkA08G020260	`PF25789`	TPR_NAA35	367	731	5e-132	441.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card