TkA08G008320 | RubberDandelionOmics

Gene overview

TkA08G008320

Reference: TK1151 Chr: Chr08 Coordinates: 2065729-2067890 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1428 bp · TkA08G008320|TK1151|cDNA

CGAGAACCTGTGTCCTTACTGCACACGCTTGACGCTCCTCTTGAACATCCAACCCTTTCTCTCTCTTAACGGCTTTAATTTGAATGTTTCCTTCTGATTCCGCAGACATCATCCTCTACCCATTCAGACCCCCAATCAGCATTCATTAGGTATTTGACCCCGTCTCCCCGGCTTTGGGTTTTCATTACAAGCTAATCGCAAACCATGTCAACAATGTCGACCGTAATATCGTATTTTGACGATGGACGAGATAATCCAGA...

CDS

Download CDS FASTA

927 bp · TkA08G008320|TK1151|CDS

ATGTCAACAATGTCGACCGTAATATCGTATTTTGACGATGGACGAGATAATCCAGAGGTGATCGATCCTCCTCAAATTGAAGATGCCATGGATGTGACCGAACATGTTCACGACCCTTCCCAAATCGCTTCAAAACCTAACGTACTCGCCACAAGCAGTGTTCGTGATTTATTGGAGTGTCCTGTTTGCTTAAATGCCATGTACCCTCCTATCCATCAGTGTTCGAATGGTCACACATTATGTTCCGGATGCAAGCCACA...

Protein

Download Protein FASTA

308 aa · TkA08G008320|TK1151|PROTEIN

MSTMSTVISYFDDGRDNPEVIDPPQIEDAMDVTEHVHDPSQIASKPNVLATSSVRDLLECPVCLNAMYPPIHQCSNGHTLCSGCKPHVHNRCPTCRHELGNIRCLALEKVAASLELPCKFQCYGCVGIYPYYSKLKHELQCVFRPYNCPYAGSECTVVGDIPHLVNHLKDGHKVDMHNGSTFNHRYVKSNPHEVENATWMLTVFSCFGQYFCLHFEAFQLGMAPVYIAFLRFMGDDDEAKNYSYSLEVGGNGRKMTWQGV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G008320`
TK1151 ID	TkA08G008320
OH-1004 ID	LXL04_034351
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G008320

Location Chr08:2065729-2067890 (-)

Description Similar to DIS1: E3 ubiquitin-protein ligase DIS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g53360`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	SINAT5 promotes ubiquitin-related degradation of NAC1 to attenuate auxin signals.2002 · DOI: 10.1038/nature00998 SINAT E3 ligases regulate the stability of the ESCRT component FREE1 in response to iron deficiency in plants.2020 · DOI: 10.1111/jipb.13005
`At3g61790`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling.2020 · DOI: 10.1105/tpc.20.00267
`At4g27880`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling.2020 · DOI: 10.1105/tpc.20.00267
`At3g58040`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	TRAF Family Proteins Regulate Autophagy Dynamics by Modulating AUTOPHAGY PROTEIN6 Stability in Arabidopsis.2017 · DOI: 10.1105/tpc.17.00056 SINAT E3 Ubiquitin Ligases Mediate FREE1 and VPS23A Degradation to Modulate Abscisic Acid Signaling.2020 · DOI: 10.1105/tpc.20.00267

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0356414`	E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins.	The SINA E3 ligase OsDIS1 negatively regulates drought response in rice.2011 · DOI: 10.1104/pp.111.180893

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0080148 negative regulation of response to water deprivation Biological Process

GO:2000785 regulation of autophagosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005771 multivesicular body Cellular Component

GO:0005776 autophagosome Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G58040

ath:AT3G61790

ath:AT4G27880

ath:AT5G53360

dosa:Os03g0356414

osa:9266295

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · TkA08G008320 · TK1151

Nucleus0.413

Rank 2 · TkA08G008320 · TK1151

Cell membrane0.087

Rank 3 · TkA08G008320 · TK1151

Endoplasmic reticulum0.066

Rank 4 · TkA08G008320 · TK1151

Mitochondrion0.065

Rank 5 · TkA08G008320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13923zf-C3HC4_259-95 aa

PF21362Sina_RING60-95 aa

PF13445zf-RING_UBOX60-85 aa

PF21361Sina_ZnF73-74 aa

PF21361Sina_ZnF109-184 aa

PF13445zf-RING_UBOX122-141 aa

PF06905FAIM1170-251 aa

PF03145Sina_TRAF204-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G008320	`PF13923`	zf-C3HC4_2	59	95	0.12	12.9
TkA08G008320	`PF21362`	Sina_RING	60	95	5.4e-13	49.6
TkA08G008320	`PF13445`	zf-RING_UBOX	60	85	3.6	8.4
TkA08G008320	`PF21361`	Sina_ZnF	73	74	3.4e-27	95.4
TkA08G008320	`PF21361`	Sina_ZnF	109	184	3.4e-27	95.4
TkA08G008320	`PF13445`	zf-RING_UBOX	122	141	3.6	8.4
TkA08G008320	`PF06905`	FAIM1	170	251	0.11	12.9
TkA08G008320	`PF03145`	Sina_TRAF	204	301	3.7e-34	117.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S3N1`	Arabidopsis thaliana	sp\|Q8S3N1\|SINA5_ARATH E3 ubiquitin-protein ligase SINAT5	82.500%	Swiss-Prot	High
`Q84JL3`	Arabidopsis thaliana	sp\|Q84JL3\|SINA3_ARATH E3 ubiquitin-protein ligase SINAT3	82.200%	Swiss-Prot	High
`Q9STN8`	Arabidopsis thaliana	sp\|Q9STN8\|SINA4_ARATH E3 ubiquitin-protein ligase SINAT4	82.100%	Swiss-Prot	High
`Q9M2P4`	Arabidopsis thaliana	sp\|Q9M2P4\|SINA2_ARATH E3 ubiquitin-protein ligase SINAT2	78.000%	Swiss-Prot	High
`Q10L91`	Oryza sativa subsp. japonica	sp\|Q10L91\|DIS1_ORYSJ E3 ubiquitin-protein ligase DIS1	85.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card