Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2397 bp · TkA07G444290|TK1151|cDNA
CTCATTTTCAGTCTTATCCCAACCCCTCTTTTGATCAGAGAATCATCAAACTCCGAGCCTCCACGTTCCCATCATCCGGCGGTTCGATCATTGGCTCGTCACCACCTCCCTCACTCCTATACGCTTTCACCTTCTCCATTCTTCTTCATCACCCCACTCTCTCACCCACCAATTAATCGTCTTCGTAATCGTAATCGTAATCTTAATCGTGATCGTGATGGGATTCCATGAGTTTACTTGATAACGAATCATCGGATGTT...
1737 bp · TkA07G444290|TK1151|CDS
ATGGGGGGAGCTTGTTCTAGAAAAAGAGTCCAACAAACCAACGAAGACATTGTTCATGGAGGAGTTTCAAGAAGATATTCCAAAAGCGGAAGCTCAAAATGGCTGGGAACCTCTTTTTCTCGAGCATCTGTAGATAACAAAGAAGGAACATCAATACCCCCTTCTCTCATGGAACTATGCATTTACAAAATCACTCAAGAAATTGATCAGTACGGTACCTTCTCGAAGCTTCCAAGAGACATTACCCAGCAGATTTTCAA...
Protein
Download Protein FASTA578 aa · TkA07G444290|TK1151|PROTEIN
MGGACSRKRVQQTNEDIVHGGVSRRYSKSGSSKWLGTSFSRASVDNKEGTSIPPSLMELCIYKITQEIDQYGTFSKLPRDITQQIFNELVYSQRLNEASLEAFLDCALQDINLGEYPGVDDTWMDVISSQGTSLLSADISGSDVTDSGLLHIKDCNNVEALNLNFCEHISDIGLGYITGLSNLTNLSLKRNTSITAKGMSVLSNLVNMSNLDLERCSGIHGGLVHLRGLKKLEALNMNCCNCITDVDMKPLSDLTNLKEL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G444290 |
|---|---|
| TK1151 ID | TkA07G444290 |
| OH-1004 ID | LXL04_009185 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 61.800 |
| Protein coverage (%) | TK1151 29.412 / OH-1004 29.565Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G444290 |
|---|---|
| Location | Chr07:112720876-112725431 (+) |
| Description | Similar to FBXL14: F-box/LRR-repeat protein 14 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0019005 SCF ubiquitin ligase complex Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function |
| KEGG gene cross-reference | hsa:144699 mmu:101358 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF23598LRR_1448-89 aaPF25013LRR_Zer-1103-148 aaPF29594LRR_SKP2119-174 aaPF25372LRR_FBXL15129-149 aaPF12799LRR_4133-172 aaPF13516LRR_6138-149 aaPF25372LRR_FBXL15139-219 aaPF25013LRR_Zer-1153-217 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G444290 | PF23598 | LRR_14 | 48 | 89 | 5.2e-19 | 68.9 |
| TkA07G444290 | PF25013 | LRR_Zer-1 | 103 | 148 | 2.1e-06 | 28.6 |
| TkA07G444290 | PF29594 | LRR_SKP2 | 119 | 174 | 1.3e-10 | 41.7 |
| TkA07G444290 | PF25372 | LRR_FBXL15 | 129 | 149 | 5.7e-24 | 85.1 |
| TkA07G444290 | PF12799 | LRR_4 | 133 | 172 | 9.3e-23 | 80.5 |
| TkA07G444290 | PF13516 | LRR_6 | 138 | 149 | 9.3e-30 | 101.0 |
| TkA07G444290 | PF25372 | LRR_FBXL15 | 139 | 219 | 5.7e-24 | 85.1 |
| TkA07G444290 | PF25013 | LRR_Zer-1 | 153 | 217 | 2.1e-06 | 28.6 |
| TkA07G444290 | PF24758 | LRR_At5g56370 | 154 | 194 | 3.5e-08 | 34.1 |
| TkA07G444290 | PF23952 | LRR_EndoS | 154 | 220 | 1.7e-05 | 25.7 |
| TkA07G444290 | PF13516 | LRR_6 | 155 | 174 | 9.3e-30 | 101.0 |
| TkA07G444290 | PF13855 | LRR_8 | 157 | 216 | 6e-27 | 93.9 |
| TkA07G444290 | PF23247 | LRR_RPS2 | 166 | 216 | 0.38 | 11.4 |
| TkA07G444290 | PF23598 | LRR_14 | 177 | 339 | 5.2e-19 | 68.9 |
| TkA07G444290 | PF13516 | LRR_6 | 181 | 203 | 9.3e-30 | 101.0 |
| TkA07G444290 | PF29594 | LRR_SKP2 | 181 | 267 | 1.3e-10 | 41.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.