RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G438040
Reference: TK1151 Chr: Chr07 Coordinates: 110903493-110906833 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1542 bp · TkA07G438040|TK1151|cDNA

ATGGAAGACCTAAAAGAACGTCTCCTCCCATCAAAACCTACGTCCAATATAACCCCTAGAGATCCATCACACAAGCCATCTTCAAATCCATATGGCCGCCAACCTTTTCAAGGAGTAGATGTTCTAGGTCTCAAAAAACGTGGTCAAGGTCTTCGATCATGGATCCGTGTAGATTCTTCATCAGGTGAAGCTCAAGTAATCGAAGTAGACAAATTCACCATGATGCGTAGATGTGATCTTCCTGCACGCGATCTTCGACT...

CDS

Download CDS FASTA

1302 bp · TkA07G438040|TK1151|CDS

ATGGAAGACCTAAAAGAACGTCTCCTCCCATCAAAACCTACGTCCAATATAACCCCTAGAGATCCATCACACAAGCCATCTTCAAATCCATATGGCCGCCAACCTTTTCAAGGAGTAGATGTTCTAGGTCTCAAAAAACGTGGTCAAGGTCTTCGATCATGGATCCGTGTAGATTCTTCATCAGGTGAAGCTCAAGTAATCGAAGTAGACAAATTCACCATGATGCGTAGATGTGATCTTCCTGCACGCGATCTTCGACT...

Protein

Download Protein FASTA

433 aa · TkA07G438040|TK1151|PROTEIN

MEDLKERLLPSKPTSNITPRDPSHKPSSNPYGRQPFQGVDVLGLKKRGQGLRSWIRVDSSSGEAQVIEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITSDEVLLLNSLDSYVLQYVVELQRRLKAPGDGDRWKGVRNFRDMFGSPSPDYLPFEFKALEVALEAACSFLDTQASELEIEAYPLLDELTSKISTSNLERVRRLKSRLVALTRRVQKVRDEIEQLMDDDGDMAEMYLTEKKGRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G438040
TK1151 IDTkA07G438040
OH-1004 IDLXL04_036913
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)49.500
Protein coverage (%)TK1151 90.069 / OH-1004 95.431
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G438040
LocationChr07:110903493-110906833 (+)
DescriptionSimilar to MRS2-I: Magnesium transporter MRS2-I
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g16010 Magnesium transporter that may mediate the influx of magnesium. No verified direct reference in this release
At1g80900 High-affinity magnesium transporter that mediates the influx of magnesium.
A novel family of magnesium transport genes in Arabidopsis.2001 · DOI: 10.1105/tpc.010352
Overexpression of an Arabidopsis magnesium transport gene, AtMGT1, in Nicotiana benthamiana confers Al tolerance.2006 · DOI: 10.1093/jxb/erl201

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2YFN7 Magnesium transporter that may mediate the influx of magnesium. No verified direct reference in this release
Os06g0650800 Magnesium transporter that may mediate the influx of magnesium. No verified direct reference in this release
UniProt: A2XV81 Magnesium transporter that may mediate the influx of magnesium. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_036913 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009555 pollen development Biological Process
GO:0015693 magnesium ion transport Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0015095 magnesium ion transmembrane transporter activity Molecular Function
KEGG gene cross-reference
ath:AT5G09690
ath:AT5G64560
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.476
Rank 1 · TkA07G438040 · TK1151
Lysosome / Vacuole0.164
Rank 2 · TkA07G438040 · TK1151
Cytoplasm0.150
Rank 3 · TkA07G438040 · TK1151
Endoplasmic reticulum0.113
Rank 4 · TkA07G438040 · TK1151
Golgi apparatus0.109
Rank 5 · TkA07G438040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22099MRS2-like67-258 aa
PF01544CorA176-246 aa
PF09523DUF2390176-240 aa
PF16740SKA2176-243 aa
PF26012HH_RND_rel187-235 aa
PF00038Filament208-259 aa
PF14644DUF4456228-244 aa
PF26012HH_RND_rel294-322 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G438040PF22099MRS2-like672581.9e-36126.3
TkA07G438040PF01544CorA1762462e-0628.0
TkA07G438040PF09523DUF23901762400.312.2
TkA07G438040PF16740SKA21762430.4711.0
TkA07G438040PF26012HH_RND_rel1872350.3112.0
TkA07G438040PF00038Filament2082590.009816.3
TkA07G438040PF14644DUF44562282440.113.1
TkA07G438040PF26012HH_RND_rel2943220.3112.0
TkA07G438040PF00038Filament3103710.009816.3
TkA07G438040PF22099MRS2-like3143611.9e-36126.3
TkA07G438040PF09523DUF23903183690.312.2
TkA07G438040PF05817Ribophorin_II3283830.06113.7
TkA07G438040PF01544CorA3324182e-0628.0
TkA07G438040PF26012HH_RND_rel3353630.3112.0
TkA07G438040PF14644DUF44563403760.113.1
TkA07G438040PF16740SKA23483660.4711.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9S9N4Arabidopsis thalianasp|Q9S9N4|MRS21_ARATH Magnesium transporter MRS2-177.700%Swiss-ProtHigh
Q9SAH0Arabidopsis thalianasp|Q9SAH0|MRS2A_ARATH Magnesium transporter MRS2-1077.400%Swiss-ProtHigh
A2YFN7Oryza sativa subsp. indicasp|A2YFN7|MRS2B_ORYSI Magnesium transporter MRS2-B71.900%Swiss-ProtHigh
Q67UQ7Oryza sativa subsp. japonicasp|Q67UQ7|MRS2B_ORYSJ Magnesium transporter MRS2-B71.900%Swiss-ProtHigh
A2XV81Oryza sativa subsp. indicasp|A2XV81|MRS2C_ORYSI Magnesium transporter MRS2-C67.600%Swiss-ProtHigh

JBrowse

View in Genome Browser