RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA07G435250
Reference: TK1151 Chr: Chr07 Coordinates: 110171098-110173932 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

768 bp · TkA07G435250|TK1151|cDNA

ATGAGAACCGCCATTGGAGCCACCACCATGCTTACCACCGCCACTTGTTTCTCTGATGAGTACTATCAACCCCATGACATGTTTATCCCCAATGATACCATTGAAGTGAATGCTCATAGCGATCAAATCTCCATCTGCAACAATTTTCAAACCTCAGATTCTCAAATGCCAATGGTTCTTCATGGCGACACTAATGAAACGACGATGCCCTCAACTAATTCTTATGGTTTGACAAAAAAGACTTGCAAAAAAACGAGGAA...

CDS

Download CDS FASTA

768 bp · TkA07G435250|TK1151|CDS

ATGAGAACCGCCATTGGAGCCACCACCATGCTTACCACCGCCACTTGTTTCTCTGATGAGTACTATCAACCCCATGACATGTTTATCCCCAATGATACCATTGAAGTGAATGCTCATAGCGATCAAATCTCCATCTGCAACAATTTTCAAACCTCAGATTCTCAAATGCCAATGGTTCTTCATGGCGACACTAATGAAACGACGATGCCCTCAACTAATTCTTATGGTTTGACAAAAAAGACTTGCAAAAAAACGAGGAA...

Protein

Download Protein FASTA

255 aa · TkA07G435250|TK1151|PROTEIN

MRTAIGATTMLTTATCFSDEYYQPHDMFIPNDTIEVNAHSDQISICNNFQTSDSQMPMVLHGDTNETTMPSTNSYGLTKKTCKKTRNENKSNIDHEKNKNVTDSKEGQSGYVYVRARRGEATDSHSLAERVRREKISEKMKALQAIVPGCDKITGKALMLEEVIHYVQSLQNQIQILSSKLACVNPMYDYGADFDASMLKPHQNMTTDQEQLLSQEHQMSNMVFENNREVMWDFEEQSQELADPFAIINSFSSFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA07G435250
TK1151 IDTkA07G435250
OH-1004 IDLXL04_009309
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)53.200
Protein coverage (%)TK1151 65.490 / OH-1004 57.453
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA07G435250
LocationChr07:110171098-110173932 (-)
DescriptionSimilar to BHLH137: Transcription factor bHLH137
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g50915 Transcription factor bHLH137. No verified direct reference in this release
At1g26260 Transcriptional activator involved in cell elongation.
Multiple bHLH proteins form heterodimers to mediate CRY2-dependent regulation of flowering-time in Arabidopsis.2013 · DOI: 10.1371/journal.pgen.1003861

Rice

Reference gene IDPossible functionPapers / DOI
Os09g0510500 Transcription activator that contributes, together with LO9-177 and ILI5/BUL1, to the promotion of leaf inclination and grain size by modulating cell elongation. No verified direct reference in this release
UniProt: A2YXI4 Together with BCL2, positive regulator of cell elongation at least partially through increased gibberellic acid (GA) biosynthesis. No verified direct reference in this release
Os08g0536800 Together with BCL2, positive regulator of cell elongation at least partially through increased gibberellic acid (GA) biosynthesis.
Modulation of Rice Leaf Angle and Grain Size by Expressing OsBCL1 and OsBCL2 under the Control of OsBUL1 Promoter.2021 · DOI: 10.3390/ijms22157792
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009309 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009739 response to gibberellin Biological Process
GO:0009740 gibberellic acid mediated signaling pathway Biological Process
GO:0010372 positive regulation of gibberellin biosynthetic process Biological Process
GO:0016036 cellular response to phosphate starvation Biological Process
GO:0042127 regulation of cell population proliferation Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0051510 regulation of unidimensional cell growth Biological Process
GO:0051511 negative regulation of unidimensional cell growth Biological Process
GO:0071368 cellular response to cytokinin stimulus Biological Process
GO:2000024 regulation of leaf development Biological Process
KEGG gene cross-reference
ath:AT3G07340
ath:AT5G50915
dosa:Os08g0536800
dosa:Os09g0510500
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971
Rank 1 · TkA07G435250 · TK1151
Cytoplasm0.113
Rank 2 · TkA07G435250 · TK1151
Cell membrane0.025
Rank 3 · TkA07G435250 · TK1151
Endoplasmic reticulum0.015
Rank 4 · TkA07G435250 · TK1151
Plastid0.011
Rank 5 · TkA07G435250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28858Ig_BT4661_5th39-127 aa
PF10937Kgd4-YMR3157-139 aa
PF02590SPOUT_MTase83-140 aa
PF00010HLH124-171 aa
PF23177bHLH_IRO3124-178 aa
PF23173bHLH_SAC51129-174 aa
PF23177bHLH_IRO3197-219 aa
PF02590SPOUT_MTase198-229 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA07G435250PF28858Ig_BT4661_5th391270.3312.4
TkA07G435250PF10937Kgd4-YMR31571390.01317.8
TkA07G435250PF02590SPOUT_MTase831400.4111.4
TkA07G435250PF00010HLH1241712e-0731.4
TkA07G435250PF23177bHLH_IRO31241780.0001722.6
TkA07G435250PF23173bHLH_SAC511291742.6e-0627.9
TkA07G435250PF23177bHLH_IRO31972190.0001722.6
TkA07G435250PF02590SPOUT_MTase1982290.4111.4
TkA07G435250PF28858Ig_BT4661_5th2102370.3312.4
TkA07G435250PF10937Kgd4-YMR312112110.01317.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93W88Arabidopsis thalianasp|Q93W88|BH137_ARATH Transcription factor bHLH13765.900%Swiss-ProtLow
Q9C670Arabidopsis thalianasp|Q9C670|BH076_ARATH Transcription factor bHLH7658.700%Swiss-ProtLow
Q0J0G7Oryza sativa subsp. japonicasp|Q0J0G7|BC1_ORYSJ Transcription factor BC165.200%Swiss-ProtLow
A2YXI4Oryza sativa subsp. indicasp|A2YXI4|BCL1_ORYSI Basic helix-loop-helix protein 8067.800%Swiss-ProtLow
A3BV95Oryza sativa subsp. japonicasp|A3BV95|BCL1_ORYSJ Basic helix-loop-helix protein 8067.800%Swiss-ProtLow

JBrowse

View in Genome Browser