TkA07G430410 | RubberDandelionOmics

Gene overview

TkA07G430410

Reference: TK1151 Chr: Chr07 Coordinates: 108914661-108915509 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

816 bp · TkA07G430410|TK1151|cDNA

ATGACGACAGGACAAGATAGACAGAACGACAAGAGGGTTGTCGTCTGTTGGAGTTGTGGGGAGAGCGGTCATGTCAGAAGCCATTGCCCGAAGCTCATGGCAGATCAAGGCCTGAGAGGCATGAACTTGGCAGAAAATAACGATGATGACGATTATGACAGTGACGAAGGGCTTCTCCTCATGTATGATCACCATGAGGTTGTTGGTGATGAGAAGCTGAAGATGAAGACGGGTGTTCCAGGTGTTGCTTCTGGTCTTGA...

CDS

Download CDS FASTA

816 bp · TkA07G430410|TK1151|CDS

ATGACGACAGGACAAGATAGACAGAACGACAAGAGGGTTGTCGTCTGTTGGAGTTGTGGGGAGAGCGGTCATGTCAGAAGCCATTGCCCGAAGCTCATGGCAGATCAAGGCCTGAGAGGCATGAACTTGGCAGAAAATAACGATGATGACGATTATGACAGTGACGAAGGGCTTCTCCTCATGTATGATCACCATGAGGTTGTTGGTGATGAGAAGCTGAAGATGAAGACGGGTGTTCCAGGTGTTGCTTCTGGTCTTGA...

Protein

Download Protein FASTA

271 aa · TkA07G430410|TK1151|PROTEIN

MTTGQDRQNDKRVVVCWSCGESGHVRSHCPKLMADQGLRGMNLAENNDDDDYDSDEGLLLMYDHHEVVGDEKLKMKTGVPGVASGLEAHTDEKVGNMRKLKQVNSKGSISDLKTADGSSRPCISSNPPKVGELGSSCSGVYDSTFSSSVGGSQIHRSPIASIGRCSARSRSSSRPQKSGSSGKSKVSGSSRTNGDDGLVADTATVRHHLVRRHTNANSSERYSSSTSNTLTCENVSSPALRMNPMQWEKARIDGLYLTLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G430410`
TK1151 ID	TkA07G430410
OH-1004 ID	LXL04_028792
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.100
Protein coverage (%)	TK1151 93.358 / OH-1004 12.817 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G430410`
Location	Chr07:108914661-108915509 (+)
Description	Similar to Retrovirus-related Pol polyprotein from transposon TNT 1-94
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_028792` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004190 aspartic-type endopeptidase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.664

Rank 1 · TkA07G430410 · TK1151

Cytoplasm0.298

Rank 2 · TkA07G430410 · TK1151

Cell membrane0.060

Rank 3 · TkA07G430410 · TK1151

Mitochondrion0.045

Rank 4 · TkA07G430410 · TK1151

Endoplasmic reticulum0.030

Rank 5 · TkA07G430410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14392zf-CCHC_414-31 aa

PF00098zf-CCHC15-31 aa

PF16588zf-C2H2_1019-31 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G430410	`PF14392`	zf-CCHC_4	14	31	0.17	12.3
TkA07G430410	`PF00098`	zf-CCHC	15	31	0.00083	20.1
TkA07G430410	`PF16588`	zf-C2H2_10	19	31	0.014	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card