Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1738 bp · TkA07G428350|TK1151|cDNA
GCGGGTTTATTTCATGGTTGAACGATTTGTCCAAGCTAGATTGCGTAGAGGAAACGATCATGGTGTGAAAGCTCAAGGAGAAGGGTGGGTGCTTACAGTTGCACTCATCGAAGGAACAAAGTTGGCTCCATTGGATTCCTCAGGTTTCTCGGATCCTTATGTAGTGTTTACATGCAACGGGAAGACAAGAACAAGTTCCGTTAAACTTCAAACCCTAGATCCACAATGGAACGAAATACTTGAGTTTGATGCTGCTGAAG...
1572 bp · TkA07G428350|TK1151|CDS
ATGGTTGAACGATTTGTCCAAGCTAGATTGCGTAGAGGAAACGATCATGGTGTGAAAGCTCAAGGAGAAGGGTGGGTGCTTACAGTTGCACTCATCGAAGGAACAAAGTTGGCTCCATTGGATTCCTCAGGTTTCTCGGATCCTTATGTAGTGTTTACATGCAACGGGAAGACAAGAACAAGTTCCGTTAAACTTCAAACCCTAGATCCACAATGGAACGAAATACTTGAGTTTGATGCTGCTGAAGAACCCCCTTCGTT...
Protein
Download Protein FASTA523 aa · TkA07G428350|TK1151|PROTEIN
MVERFVQARLRRGNDHGVKAQGEGWVLTVALIEGTKLAPLDSSGFSDPYVVFTCNGKTRTSSVKLQTLDPQWNEILEFDAAEEPPSLLDVEVFDFDGPFGQPASLGHAEIRFLRHTSEELADMWVPLEGKLAQSFQSKLHLRIFLDNNNGVETIKEYLTKVEKEAGKKLNVKSPHRNSTFQKLFSLPPEEFLISDFSCSLKRKLPLQGRLFVSSRIIGFYANLFGHKTRFSFLWEDVEDIHVLPPSIRSVGSPILVMVLH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G428350 |
|---|---|
| TK1151 ID | TkA07G428350 |
| OH-1004 ID | LXL04_034779 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 52.500 |
| Protein coverage (%) | TK1151 98.088 / OH-1004 45.462Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G428350 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr07:108331833-108336180 (+) | |||||||||
| Description | Similar to At1g03370: C2 and GRAM domain-containing protein At1g03370 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009663 plasmodesma organization Biological Process GO:0009911 positive regulation of flower development Biological Process GO:0010228 vegetative to reproductive phase transition of meristem Biological Process GO:0048574 long-day photoperiodism, flowering Biological Process GO:0050832 defense response to fungus Biological Process GO:0005576 extracellular region Cellular Component GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009511 plasmodesmatal endoplasmic reticulum Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G03370 ath:AT1G22610 ath:AT3G59660 ath:AT5G50170 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00168C226-127 aaPF02893GRAM179-276 aaPF16016VASt355-496 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA07G428350 | PF00168 | C2 | 26 | 127 | 4.8e-18 | 66.0 |
| TkA07G428350 | PF02893 | GRAM | 179 | 276 | 1.6e-16 | 60.8 |
| TkA07G428350 | PF16016 | VASt | 355 | 496 | 7.4e-22 | 79.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.