TkA07G428330 | RubberDandelionOmics

Gene overview

TkA07G428330

Reference: TK1151 Chr: Chr07 Coordinates: 108330113-108330646 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

498 bp · TkA07G428330|TK1151|cDNA

TTCCTCCCTCCACGTTTCCCCTTTCAATGGCCGTCTTCATCACCATCTCCATTTCCACCTCTACTTCCATCTCCCACTTCAATAAATCAAAACCTATCTCACTTTCCATCAAAAATTCACTCTTTCTGCCGCACAATGAGGCTCTACGTTTACGTATTAGAGGGTCGTGATTTGGTCGTTCAAGACTCTTTCGTGAAATTAAGACTCGGAAAGTTTAAATCAAGGACGAGAGTTTTGAAGAACACGAAGAACCCTATTTG...

CDS

Download CDS FASTA

498 bp · TkA07G428330|TK1151|CDS

TTCCTCCCTCCACGTTTCCCCTTTCAATGGCCGTCTTCATCACCATCTCCATTTCCACCTCTACTTCCATCTCCCACTTCAATAAATCAAAACCTATCTCACTTTCCATCAAAAATTCACTCTTTCTGCCGCACAATGAGGCTCTACGTTTACGTATTAGAGGGTCGTGATTTGGTCGTTCAAGACTCTTTCGTGAAATTAAGACTCGGAAAGTTTAAATCAAGGACGAGAGTTTTGAAGAACACGAAGAACCCTATTTG...

Protein

Download Protein FASTA

165 aa · TkA07G428330|TK1151|PROTEIN

FLPPRFPFQWPSSSPSPFPPLLPSPTSINQNLSHFPSKIHSFCRTMRLYVYVLEGRDLVVQDSFVKLRLGKFKSRTRVLKNTKNPIWNEEFAFRVHSLDDDELIVSVYNRHDESTGFFNNGFRDLVGRVRIPLWSVANEENHHLPPTWFSIENHKSDKSITKESG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G428330`
TK1151 ID	TkA07G428330
OH-1004 ID	LXL04_034779
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	33.300
Protein coverage (%)	TK1151 72.727 / OH-1004 10.122 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G428330

Location Chr07:108330113-108330646 (+)

Description Similar to At1g03370: C2 and GRAM domain-containing protein At1g03370

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50170`	C2 and GRAM domain-containing protein At5g50170.	No verified direct reference in this release
`At1g03370`	C2 and GRAM domain-containing protein At1g03370.	No verified direct reference in this release
`At4g20080`	May function as a signaling molecule by regulating the trafficking of other regulators.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X479`	Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity (By similarity).	No verified direct reference in this release
`Os02g0327000`	Mediates the transient calcium-dependent interaction of PYR/PYL/RCAR abscisic acid (ABA) receptors with the plasma membrane and thus regulates ABA sensitivity (By similarity).	Constitutive expression of a rice GTPase-activating protein induces defense responses.2008 · DOI: 10.1111/j.1469-8137.2008.02473.x An ancient P-loop GTPase in rice is regulated by a higher plant-specific regulatory protein.2010 · DOI: 10.1074/jbc.m110.172080 Site-directed Mutagenesis Shows the Significance of Interactions with Phospholipids and the G-protein OsYchF1 for the Physiological Functions of the Rice GTPase-activating Protein 1 (OsGAP1).2015 · DOI: 10.1074/jbc.m115.655639

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034779 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009663 plasmodesma organization Biological Process

GO:0009911 positive regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0048574 long-day photoperiodism, flowering Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009511 plasmodesmatal endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT1G03370

ath:AT1G22610

ath:AT3G59660

ath:AT5G50170

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.406

Rank 1 · TkA07G428330 · TK1151

Nucleus0.333

Rank 2 · TkA07G428330 · TK1151

Cell membrane0.207

Rank 3 · TkA07G428330 · TK1151

Endoplasmic reticulum0.098

Rank 4 · TkA07G428330 · TK1151

Mitochondrion0.072

Rank 5 · TkA07G428330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00168C247-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G428330	`PF00168`	C2	47	149	2.7e-17	63.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGS8`	Arabidopsis thaliana	sp\|Q9FGS8\|C2GR2_ARATH C2 and GRAM domain-containing protein At5g50170	45.900%	Swiss-Prot	Medium
`Q9ZVT9`	Arabidopsis thaliana	sp\|Q9ZVT9\|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370	39.700%	Swiss-Prot	Medium
`O49435`	Arabidopsis thaliana	sp\|O49435\|MCT11_ARATH Multiple C2 domain and transmembrane region protein 11	31.500%	Swiss-Prot	Medium
`A2X479`	Oryza sativa subsp. indica	sp\|A2X479\|GAP1_ORYSI GTPase activating protein 1	36.300%	Swiss-Prot	Medium
`Q6YWF1`	Oryza sativa subsp. japonica	sp\|Q6YWF1\|GAP1_ORYSJ GTPase activating protein 1	36.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card