TkA07G427130 | RubberDandelionOmics

Gene overview

TkA07G427130

Reference: TK1151 Chr: Chr07 Coordinates: 108029200-108037212 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5117 bp · TkA07G427130|TK1151|cDNA

GTGAGATCAGCAGTCTTCATCTCGTACTTCCCCACCTTCGTATATATCTCCCTTCTCCGTAAGATTCATAAGAAACCACAAGCCCTACTTCCCTCTTCTTCTTATTCACTTCTCCAGCTGTGATCTCTCATATCTACAGATTTCCACACTCCAATCGAAATCCATTGATCCAGTGAAGAACAAGCGAGCTTCAGGGGAGATAGAGTGAGTGGGATCATTACTATACAGAGAGAGAATTGCTTCTGTATGTCAGTAGATTG...

CDS

Download CDS FASTA

2319 bp · TkA07G427130|TK1151|CDS

ATGGCCCCAACTTCGCAAAAGACGCCGCATTCTACCGATGATTCACTTCCGATCCACCGTCAGGCGGTTTCGGCCGACGTCGTTGTTGTCGAGAACTGGCACAATAACGATCAGAAGACTCCGATTAAGAATTCATCAATCGCTACCTTGATCAATCCTACCGATCCTTCCGCTTCCACTAAAGGAATCCAAATCCTCACAAGGGCTCAAACAAGCCATCCACTGGACCCACTCTCTGCTGCTGAAATCAAAGTAGCTGT...

Protein

Download Protein FASTA

772 aa · TkA07G427130|TK1151|PROTEIN

MAPTSQKTPHSTDDSLPIHRQAVSADVVVVENWHNNDQKTPIKNSSIATLINPTDPSASTKGIQILTRAQTSHPLDPLSAAEIKVAVATVRAAGATPEVRDGMRFVEVVLSEPDKSVVALADAYFFPPFQPNLLPRSKGGAVIPSKLPPRRARLVVYNKKSNETSIWIVELSEVHATTRGGHHRGKVVASKTIKDVQPPMDAVEYAECEAVVKEYLPFQEAMKKRGIEDMDLVMVDAWCVGYHSEADAPSRRLAKPLIFC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G427130`
TK1151 ID	TkA07G427130
OH-1004 ID	LXL04_030736
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G427130

Location Chr07:108029200-108037212 (-)

Description Similar to maoI: Primary amine oxidase (Arthrobacter sp. (strain P1)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42490`	Involved in putrescine catabolism in peroxisomes.	Copper-containing amine oxidases contribute to terminal polyamine oxidation in peroxisomes and apoplast of Arabidopsis thaliana.2013 · DOI: 10.1186/1471-2229-13-109

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030736 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0009308 amine metabolic process Biological Process

GO:0009447 putrescine catabolic process Biological Process

GO:0009611 response to wounding Biological Process

GO:0009733 response to auxin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0010311 lateral root formation Biological Process

GO:0042179 nicotine biosynthetic process Biological Process

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT2G42490

nta:107768026

nta:107807126

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.449

Rank 1 · TkA07G427130 · TK1151

Cytoplasm0.255

Rank 2 · TkA07G427130 · TK1151

Endoplasmic reticulum0.118

Rank 3 · TkA07G427130 · TK1151

Mitochondrion0.102

Rank 4 · TkA07G427130 · TK1151

Nucleus0.097

Rank 5 · TkA07G427130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02727Cu_amine_oxidN273-162 aa

PF21994AGAO-like_N280-120 aa

PF21994AGAO-like_N2148-172 aa

PF02728Cu_amine_oxidN3204-311 aa

PF01179Cu_amine_oxid338-741 aa

PF07812TfuA503-585 aa

PF21994AGAO-like_N2746-759 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G427130	`PF02727`	Cu_amine_oxidN2	73	162	5.9e-06	27.2
TkA07G427130	`PF21994`	AGAO-like_N2	80	120	0.17	12.9
TkA07G427130	`PF21994`	AGAO-like_N2	148	172	0.17	12.9
TkA07G427130	`PF02728`	Cu_amine_oxidN3	204	311	1.6e-24	86.8
TkA07G427130	`PF01179`	Cu_amine_oxid	338	741	2.6e-155	517.9
TkA07G427130	`PF07812`	TfuA	503	585	0.0067	16.9
TkA07G427130	`PF21994`	AGAO-like_N2	746	759	0.17	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L866`	Arabidopsis thaliana	sp\|Q8L866\|CUAOZ_ARATH Amine oxidase [copper-containing] zeta, peroxisomal	79.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card