TkA07G425900 | RubberDandelionOmics

Gene overview

TkA07G425900

Reference: TK1151 Chr: Chr07 Coordinates: 107653469-107656953 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3270 bp · TkA07G425900|TK1151|cDNA

TTGCACTAAAATTATATAATTTTCTAGATGTTTACACGTGCGCATAGTATCACTCGCCATCAACCACCAAACACCCTCTTAACTCTAATGTATGCAGGCACTTCGATCCACTTTGTAACTCAAACCCTCTTAACAACATAACCGAATCTTTCTCTTCGCATCTTTCCCCGATCAAATCCAACCAAACAAGCCCTAATTTCTCTTCTTCTCTTCATCTTCATCTTCCAGTTCTTCGCAAATGTAATTAGTTTTCAGCTGTG...

CDS

Download CDS FASTA

2745 bp · TkA07G425900|TK1151|CDS

ATGGAAACCCCAAACCCCGAAGAAACCCTAATTGAGGGTTTAGTGACATCTAATCAAGGTGGAAATGCGAATCTATTGGAAGAAAAAGCTAATTCGTTTGATTTGGGGGAAGATAACTCCGCTAAACCTTACTCACCACAAGTTTCGGAAAATGTTGATTTGAGCAGCCATGCAGATGTTCATATGAAAGGTATTTCGCTTTTTGTGGAATTAACTGGCGATTTGGAGCATGGATCATCAAAGGGGAATAATCAGAGTGA...

Protein

Download Protein FASTA

914 aa · TkA07G425900|TK1151|PROTEIN

METPNPEETLIEGLVTSNQGGNANLLEEKANSFDLGEDNSAKPYSPQVSENVDLSSHADVHMKGISLFVELTGDLEHGSSKGNNQSEIVDAYKHCGVNVGDLVWAMIRKQTWWPGIVCEASSVQIRENGILVRCFGNGNYIWCHPDELKTFIQHFEQLLSLSSNQRRSKMFFSAIDEALSEVGNRVKKEFTCSCFSKVVEKRVDNHDISLTRFDPATFFDYVKDLARDVSSVNKIDYEINKSILSAFNRSLGHCQIPIHQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G425900`
TK1151 ID	TkA07G425900
OH-1004 ID	LXL04_030719
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.556 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G425900

Location Chr07:107653469-107656953 (-)

Description Similar to ATM: Serine/threonine-protein kinase ATM

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40340`	Together with PDP1, PDP2 and PDP6, interacts with MSI4/FVE and MSI5 to suppress FLC, MAF4 and MAF5 expression by regulating the function of the PRC2 complex and modulating H3K27me3 level, thereby promoting flowering.	Arabidopsis PWWP domain proteins mediate H3K27 trimethylation on FLC and regulate flowering time.2018 · DOI: 10.1111/jipb.12630

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030719 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006281 DNA repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009908 flower development Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0010332 response to gamma radiation Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0033044 regulation of chromosome organization Biological Process

KEGG gene cross-reference

ath:AT3G09670

ath:AT5G40340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA07G425900 · TK1151

Cytoplasm0.073

Rank 2 · TkA07G425900 · TK1151

Cell membrane0.026

Rank 3 · TkA07G425900 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA07G425900 · TK1151

Plastid0.011

Rank 5 · TkA07G425900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00855PWWP100-181 aa

PF08169RBB1NT108-151 aa

PF18962Por_Secre_tail320-348 aa

PF00855PWWP335-346 aa

PF00855PWWP407-444 aa

PF00855PWWP554-579 aa

PF18962Por_Secre_tail615-655 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G425900	`PF00855`	PWWP	100	181	2.7e-13	50.9
TkA07G425900	`PF08169`	RBB1NT	108	151	0.16	12.8
TkA07G425900	`PF18962`	Por_Secre_tail	320	348	0.068	14.1
TkA07G425900	`PF00855`	PWWP	335	346	2.7e-13	50.9
TkA07G425900	`PF00855`	PWWP	407	444	2.7e-13	50.9
TkA07G425900	`PF00855`	PWWP	554	579	2.7e-13	50.9
TkA07G425900	`PF18962`	Por_Secre_tail	615	655	0.068	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FNE4`	Arabidopsis thaliana	sp\|Q9FNE4\|PDP3_ARATH PWWP domain-containing protein 3	27.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card