TkA07G422710 | RubberDandelionOmics

Gene overview

TkA07G422710

Reference: TK1151 Chr: Chr07 Coordinates: 106866587-106867540 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

954 bp · TkA07G422710|TK1151|cDNA

ATGGCATCAATGAAGTTAAAGCTCACCATCCACTCTGCAAAAGATCTAAACAACGTGAAATACATGGGCACCATGAGCCCATATGCCATCATATCAATGGCCAACAATGGCAAATTCAGAACGAGTACTGCCATGAACGGGGGCTTGAATCCCATCTGGAATGAGTCCGTGGAATTCAACATAAACCAAGATGAATGCATGAAAGGAAACCAAGTCATTATCTTCGATATCTATCATGGTGGGATAGTGTTTGATAGAAC...

CDS

Download CDS FASTA

954 bp · TkA07G422710|TK1151|CDS

ATGGCATCAATGAAGTTAAAGCTCACCATCCACTCTGCAAAAGATCTAAACAACGTGAAATACATGGGCACCATGAGCCCATATGCCATCATATCAATGGCCAACAATGGCAAATTCAGAACGAGTACTGCCATGAACGGGGGCTTGAATCCCATCTGGAATGAGTCCGTGGAATTCAACATAAACCAAGATGAATGCATGAAAGGAAACCAAGTCATTATCTTCGATATCTATCATGGTGGGATAGTGTTTGATAGAAC...

Protein

Download Protein FASTA

317 aa · TkA07G422710|TK1151|PROTEIN

MASMKLKLTIHSAKDLNNVKYMGTMSPYAIISMANNGKFRTSTAMNGGLNPIWNESVEFNINQDECMKGNQVIIFDIYHGGIVFDRTIGQVQVPLKHLLLKHACGEKVNYPVTSASGGEEGSIIISYILSIVSEGSKVVDDDPHKSMVSKKLKLVVHSAKDLNNVKLMGTMNPYAMVSITGGSSRFRTSTVTNGGSNPVWNSFMEFKIDEDACTQVVMVEMFHNGTAFDRPIGQVQVSLEDLLLGHASGEKVSYPVMGEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G422710`
TK1151 ID	TkA07G422710
OH-1004 ID	LXL04_030678
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G422710`
Location	Chr07:106866587-106867540 (+)
Description	Similar to SYT4: Synaptotagmin-4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030678` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006623 protein targeting to vacuole Biological Process GO:0006869 lipid transport Biological Process GO:0006952 defense response Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0017158 regulation of calcium ion-dependent exocytosis Biological Process GO:0031340 positive regulation of vesicle fusion Biological Process GO:0033299 secretion of lysosomal enzymes Biological Process GO:0061025 membrane fusion Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0000326 protein storage vacuole Cellular Component GO:0005576 extracellular region Cellular Component GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference	ath:AT1G09070 ath:AT5G11100 dme:Dmel_CG3139 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.429

Rank 1 · TkA07G422710 · TK1151

Cell membrane0.293

Rank 2 · TkA07G422710 · TK1151

Nucleus0.213

Rank 3 · TkA07G422710 · TK1151

Lysosome / Vacuole0.120

Rank 4 · TkA07G422710 · TK1151

Endoplasmic reticulum0.120

Rank 5 · TkA07G422710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01379Porphobil_deam3-19 aa

PF00168C25-102 aa

PF29403C2_CERLI269-127 aa

PF01379Porphobil_deam145-164 aa

PF00168C2151-247 aa

PF29403C2_CERLI2177-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G422710	`PF01379`	Porphobil_deam	3	19	0.23	11.7
TkA07G422710	`PF00168`	C2	5	102	2.8e-35	121.4
TkA07G422710	`PF29403`	C2_CERLI2	69	127	0.084	13.7
TkA07G422710	`PF01379`	Porphobil_deam	145	164	0.23	11.7
TkA07G422710	`PF00168`	C2	151	247	2.8e-35	121.4
TkA07G422710	`PF29403`	C2_CERLI2	177	267	0.084	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card