TkA07G422670 | RubberDandelionOmics

Gene overview

TkA07G422670

Reference: TK1151 Chr: Chr07 Coordinates: 106855290-106857278 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1617 bp · TkA07G422670|TK1151|cDNA

ATGTCGGTATCAAAAAGAACATTCCGGATGTTCGTCGAGGAAGAACTAGGCGAATTCCCACATTTCATTGTAGGAGCCATGCTCGAATGGTTACTGATAGTTTCCCTTTTCGTGGACCGTTTTCTGGCCTCTGTCTCCAATAAATTTGCTACATTGTTCGAACTGGACCCACCCTGCGTCCTGTGCACACGAATCGACCAATCACTCATGGGAACGAACCCAAGCACCTTCTACAACAACTCCATATGCGAATCCCACAA...

CDS

Download CDS FASTA

1617 bp · TkA07G422670|TK1151|CDS

ATGTCGGTATCAAAAAGAACATTCCGGATGTTCGTCGAGGAAGAACTAGGCGAATTCCCACATTTCATTGTAGGAGCCATGCTCGAATGGTTACTGATAGTTTCCCTTTTCGTGGACCGTTTTCTGGCCTCTGTCTCCAATAAATTTGCTACATTGTTCGAACTGGACCCACCCTGCGTCCTGTGCACACGAATCGACCAATCACTCATGGGAACGAACCCAAGCACCTTCTACAACAACTCCATATGCGAATCCCACAA...

Protein

Download Protein FASTA

538 aa · TkA07G422670|TK1151|PROTEIN

MSVSKRTFRMFVEEELGEFPHFIVGAMLEWLLIVSLFVDRFLASVSNKFATLFELDPPCVLCTRIDQSLMGTNPSTFYNNSICESHKKDISSLAYCHVHRKLSDIRNMCEPCLLSFATDKESDFDEIKKQPAEQKDTDQNKDTDKKMTPNLKPVKTKETGGGNNGSNRDVEMMSKCCCCGEAFTTRTPSKAFVRTPAHFHGTSVLTPRAPLTPMGWRNDDAKNAELPHVRYASLNFTSENQPDAAKDNNHESKVGKNDSK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G422670`
TK1151 ID	TkA07G422670
OH-1004 ID	LXL04_030677
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G422670

Location Chr07:106855290-106857278 (-)

Description Similar to MYOB6: Probable myosin-binding protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74830`	Probable membrane-anchored myosin receptors.	No verified direct reference in this release
`At1g18990`	Probable membrane-anchored myosin receptors.	No verified direct reference in this release
`At5g16720`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	No verified direct reference in this release
`At1g08800`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	Identification of myosin XI receptors in Arabidopsis defines a distinct class of transport vesicles.2013 · DOI: 10.1105/tpc.113.113704
`At2g30690`	Membrane-anchored myosin receptors that define a distinct, plant-specific transport vesicle compartment.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030677 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0016020 membrane Cellular Component

GO:0030133 transport vesicle Cellular Component

GO:0017022 myosin binding Molecular Function

GO:0080115 myosin XI tail binding Molecular Function

KEGG gene cross-reference

ath:AT1G08800

ath:AT1G18990

ath:AT1G74830

ath:AT5G16720

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.340

Rank 1 · TkA07G422670 · TK1151

Nucleus0.305

Rank 2 · TkA07G422670 · TK1151

Mitochondrion0.151

Rank 3 · TkA07G422670 · TK1151

Cell membrane0.147

Rank 4 · TkA07G422670 · TK1151

Endoplasmic reticulum0.112

Rank 5 · TkA07G422670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04576Zein-binding329-419 aa

PF24590DUF7615332-402 aa

PF11055Gsf2367-446 aa

PF22885DUF7020416-479 aa

PF24590DUF7615481-494 aa

PF24590DUF7615522-538 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G422670	`PF04576`	Zein-binding	329	419	4.4e-33	114.1
TkA07G422670	`PF24590`	DUF7615	332	402	8.1	7.7
TkA07G422670	`PF11055`	Gsf2	367	446	0.071	12.6
TkA07G422670	`PF22885`	DUF7020	416	479	0.041	14.8
TkA07G422670	`PF24590`	DUF7615	481	494	8.1	7.7
TkA07G422670	`PF24590`	DUF7615	522	538	8.1	7.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HVS6`	Arabidopsis thaliana	sp\|F4HVS6\|MYOB6_ARATH Probable myosin-binding protein 6	40.600%	Swiss-Prot	Medium
`Q9LMC8`	Arabidopsis thaliana	sp\|Q9LMC8\|MYOB5_ARATH Probable myosin-binding protein 5	37.800%	Swiss-Prot	Medium
`Q0WNW4`	Arabidopsis thaliana	sp\|Q0WNW4\|MYOB3_ARATH Myosin-binding protein 3	26.800%	Swiss-Prot	Low
`F4HXQ7`	Arabidopsis thaliana	sp\|F4HXQ7\|MYOB1_ARATH Myosin-binding protein 1	47.200%	Swiss-Prot	Low
`F4INW9`	Arabidopsis thaliana	sp\|F4INW9\|MYOB4_ARATH Probable myosin-binding protein 4	44.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card