TkA07G415410 | RubberDandelionOmics

Gene overview

TkA07G415410

Reference: TK1151 Chr: Chr07 Coordinates: 104990842-104996908 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2337 bp · TkA07G415410|TK1151|cDNA

GAAAACAGAATCTTCTTCTACCACTGCAACAATCCAACTCCTTGCTCCGCCTGCAATGGCGACGACATCGGAGACTCTAAAAACACCGATCTCGGAGATTCCAAAGGCGAAGTCGGGATCCTTTCCGTCGATAGTTAAGGCGTATTGGCTGCCGGCGATCCTATTCTCCGCCTCCATGTTCTTCCAGCTTGTAGCTATTCCTCGTTCTTTTCCGCCTTCTCATTACGACGTTCTAGGGATCAAAACCTACAGTTCAATTG...

CDS

Download CDS FASTA

2541 bp · TkA07G415410|TK1151|CDS

ATGGATGAAATTGCCAAACGGGGTAAAAGGCGAAACAAACTTAGCACCTCAAACTTGCCCAACTCTCAGGACGACCCTTACAATGTCGACCTAGATGACGACCTTCCCCCTCCACCACCACGGAATTTGCCCATGGGTAGAGATCGAGCGAAGAAGAAAGCAAAGACGAGTAGTTCGGAGTCCGCAAGATCGTCTTCCGCAAGATCGGATGAGCTAGCTGAAATCAGAAATCAGTTTGCCACCATGAATGCCCAACTCTC...

Protein

Download Protein FASTA

846 aa · TkA07G415410|TK1151|PROTEIN

MDEIAKRGKRRNKLSTSNLPNSQDDPYNVDLDDDLPPPPPRNLPMGRDRAKKKAKTSSSESARSSSARSDELAEIRNQFATMNAQLSSRNELRAIELYMRPISHLQGAFGLTSVQNPTQTRPGVRLRGIFLFIPQVGSGRLVKPKPQNLKRKTESSSTTATIQLLAPPAMATTSETLKTPISEIPKAKSGSFPSIVKAYWLPAILFSASMFFQLVAIPRSFPPSHYDVLGIKTYSSIEQVNEAYQHLSSNWKTGSQPSST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G415410`
TK1151 ID	TkA07G415410
OH-1004 ID	LXL04_030616
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 83.333 / OH-1004 98.739 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA07G415410`
Location	Chr07:104990842-104996908 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030616` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.536

Rank 1 · TkA07G415410 · TK1151

Nucleus0.197

Rank 2 · TkA07G415410 · TK1151

Cytoplasm0.094

Rank 3 · TkA07G415410 · TK1151

Golgi apparatus0.089

Rank 4 · TkA07G415410 · TK1151

Mitochondrion0.071

Rank 5 · TkA07G415410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20570DUF677953-88 aa

PF00226DnaJ225-283 aa

PF13905Thioredoxin_8343-364 aa

PF13905Thioredoxin_8462-529 aa

PF20570DUF6779587-602 aa

PF13905Thioredoxin_8648-668 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G415410	`PF20570`	DUF6779	53	88	2.2	9.7
TkA07G415410	`PF00226`	DnaJ	225	283	6.3e-06	26.9
TkA07G415410	`PF13905`	Thioredoxin_8	343	364	0.18	12.9
TkA07G415410	`PF13905`	Thioredoxin_8	462	529	0.18	12.9
TkA07G415410	`PF20570`	DUF6779	587	602	2.2	9.7
TkA07G415410	`PF13905`	Thioredoxin_8	648	668	0.18	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card