Gene Card
Gene overview
cDNA / CDS / Protein Sequences
546 bp · TkA07G413750|TK1151|cDNA
ATGGATATCATGAACAATGAAGAGTTTAGATTAAAGAATTACGCCATATCTGCAATAGTTATATCACGCACGCTTTGGGATGGTCTCTCCGCCTCCCGTCTCCCTCCCTCGAACCCAGTCGACATTCTGCTCAAACATTCTGCTGCGACTTCTGCTGCAACCTTCTGCTGTGACCTTCTGATTTCCGGCGATTCCACCGGCGCACCTCCACTGCGACGCACGTTAACAGCCCCGACGACCTCCTCCAGCCGGCGTTTCCA...
546 bp · TkA07G413750|TK1151|CDS
ATGGATATCATGAACAATGAAGAGTTTAGATTAAAGAATTACGCCATATCTGCAATAGTTATATCACGCACGCTTTGGGATGGTCTCTCCGCCTCCCGTCTCCCTCCCTCGAACCCAGTCGACATTCTGCTCAAACATTCTGCTGCGACTTCTGCTGCAACCTTCTGCTGTGACCTTCTGATTTCCGGCGATTCCACCGGCGCACCTCCACTGCGACGCACGTTAACAGCCCCGACGACCTCCTCCAGCCGGCGTTTCCA...
Protein
Download Protein FASTA181 aa · TkA07G413750|TK1151|PROTEIN
MDIMNNEEFRLKNYAISAIVISRTLWDGLSASRLPPSNPVDILLKHSAATSAATFCCDLLISGDSTGAPPLRRTLTAPTTSSSRRFQRYSFQPRRPFQSDFCSIYARFVPNDFRLFILDLGFNSNDFRWIMSCSRFLLDLRFNSRNRRFLFHPPFPLPSPSSKQLFKLKNLLHVSCGSAGS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA07G413750 |
|---|---|
| TK1151 ID | TkA07G413750 |
| OH-1004 ID | LXL04_010393 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 63.300 |
| Protein coverage (%) | TK1151 25.414 / OH-1004 7.481Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA07G413750 |
|---|---|
| Location | Chr07:104529235-104530684 (+) |
| Description | Similar to DMR6: Protein DOWNY MILDEW RESISTANCE 6 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002229 defense response to oomycetes Biological Process GO:0002238 response to molecule of fungal origin Biological Process GO:0002239 response to oomycetes Biological Process GO:0009617 response to bacterium Biological Process GO:0009620 response to fungus Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009805 coumarin biosynthetic process Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0010150 leaf senescence Biological Process GO:0042742 defense response to bacterium Biological Process GO:0046244 salicylic acid catabolic process Biological Process GO:0071456 cellular response to hypoxia Biological Process |
| KEGG gene cross-reference | ag:BAA78340 ath:AT4G10500 ath:AT5G24530 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.