TkA07G413430 | RubberDandelionOmics

Gene overview

TkA07G413430

Reference: TK1151 Chr: Chr07 Coordinates: 104437860-104439173 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1314 bp · TkA07G413430|TK1151|cDNA

ATGGCGTCTCGAATCATAACCAGAACCCTCATTCTCCCGAAAACCAACAACCGAATCCCATATCAAATCCCTCAATTTTCTTCATCAATCTGCAGCAACACAACTCCTCTTTCAAATCTCTTCCAAAGGTACGGTTTCCCACCTTCTGACCTCCATACGTTCTTCGTAAAGAACAGATTTTTGCTCGATTCCAGCGTTCCCAATGTCGAAATGTCCTTGAAAGTCCTGTCATCATTCTCTACTTCCAAGATTTTTGTTGT...

CDS

Download CDS FASTA

1314 bp · TkA07G413430|TK1151|CDS

ATGGCGTCTCGAATCATAACCAGAACCCTCATTCTCCCGAAAACCAACAACCGAATCCCATATCAAATCCCTCAATTTTCTTCATCAATCTGCAGCAACACAACTCCTCTTTCAAATCTCTTCCAAAGGTACGGTTTCCCACCTTCTGACCTCCATACGTTCTTCGTAAAGAACAGATTTTTGCTCGATTCCAGCGTTCCCAATGTCGAAATGTCCTTGAAAGTCCTGTCATCATTCTCTACTTCCAAGATTTTTGTTGT...

Protein

Download Protein FASTA

437 aa · TkA07G413430|TK1151|PROTEIN

MASRIITRTLILPKTNNRIPYQIPQFSSSICSNTTPLSNLFQRYGFPPSDLHTFFVKNRFLLDSSVPNVEMSLKVLSSFSTSKIFVVSMVNSCPKVLELEFLKKWETGISKLGILTNSSPKMTQNILEVSRKFDLYPDDVLHCIQCLQGFRFTPATISRVLEELPMIITMNEDKIWGKIEFLLGIGIHRSKIDSIIQTYPGILGFAVENKLKPLISEFTEMGFKPNEIREEIIKNPKILQSEVGELSKCLRMLNSLKCRV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G413430`
TK1151 ID	TkA07G413430
OH-1004 ID	LXL04_030580
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	95.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G413430

Location Chr07:104437860-104439173 (+)

Description Similar to MTERF15: Transcription termination factor MTERF15, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74120`	Transcription termination factor required for mitochondrial NAD2 intron 3 splicing and normal membrane respiratory chain Complex I activity.	Arabidopsis mTERF15 is required for mitochondrial nad2 intron 3 splicing and functional complex I activity.2014 · DOI: 10.1371/journal.pone.0112360

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030580 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation Biological Process

GO:0006353 DNA-templated transcription termination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006393 termination of mitochondrial transcription Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

KEGG gene cross-reference

ath:AT1G74120

ath:AT4G02990

ath:AT5G54180

ath:AT5G55580

dosa:Os05g0404000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.799

Rank 1 · TkA07G413430 · TK1151

Plastid0.118

Rank 2 · TkA07G413430 · TK1151

Nucleus0.058

Rank 3 · TkA07G413430 · TK1151

Cytoplasm0.034

Rank 4 · TkA07G413430 · TK1151

Cell membrane0.010

Rank 5 · TkA07G413430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536mTERF41-102 aa

PF02536mTERF179-257 aa

PF21267UBA2_UBAP-1214-230 aa

PF02536mTERF218-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G413430	`PF02536`	mTERF	41	102	8.5e-34	117.6
TkA07G413430	`PF02536`	mTERF	179	257	8.5e-34	117.6
TkA07G413430	`PF21267`	UBA2_UBAP-1	214	230	0.17	12.9
TkA07G413430	`PF02536`	mTERF	218	379	8.5e-34	117.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6A1`	Arabidopsis thaliana	sp\|Q9C6A1\|MTEFE_ARATH Transcription termination factor MTERF15, mitochondrial	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card