TkA07G411920 | RubberDandelionOmics

Gene overview

TkA07G411920

Reference: TK1151 Chr: Chr07 Coordinates: 104078948-104079358 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA07G411920|TK1151|cDNA

ATGAAATCTGCTGGATCACTGAATCCCTCAATACAAAAGCTTTACTACGACTTTCTTAAAATCCTATGTGGAATTGAGAGGGTTGACCATGCGTTGACTGTTTTTGCAAAGATGAAGAAAGACGGGTGTGAACCAGGGATCCAGACTTATGATCTTTTGATGGGGAAGCTTTGTGGTCATGGGCGTGTTGAAAAGGCGAATGTTCTTTTTAAAGAAGCTGAGAATAAGGGTTTAGGGGTTGTACCAAAGGCTTATAAATT...

CDS

Download CDS FASTA

411 bp · TkA07G411920|TK1151|CDS

ATGAAATCTGCTGGATCACTGAATCCCTCAATACAAAAGCTTTACTACGACTTTCTTAAAATCCTATGTGGAATTGAGAGGGTTGACCATGCGTTGACTGTTTTTGCAAAGATGAAGAAAGACGGGTGTGAACCAGGGATCCAGACTTATGATCTTTTGATGGGGAAGCTTTGTGGTCATGGGCGTGTTGAAAAGGCGAATGTTCTTTTTAAAGAAGCTGAGAATAAGGGTTTAGGGGTTGTACCAAAGGCTTATAAATT...

Protein

Download Protein FASTA

136 aa · TkA07G411920|TK1151|PROTEIN

MKSAGSLNPSIQKLYYDFLKILCGIERVDHALTVFAKMKKDGCEPGIQTYDLLMGKLCGHGRVEKANVLFKEAENKGLGVVPKAYKLDPRFMKKPKMVKEKKRETLPEKMARKRRRLKKIRLSFVKKPKKAQRRAY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G411920`
TK1151 ID	TkA07G411920
OH-1004 ID	LXL04_030572
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.300
Protein coverage (%)	TK1151 99.265 / OH-1004 25.862 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G411920

Location Chr07:104078948-104079358 (-)

Description Similar to PNM1: Pentatricopeptide repeat-containing protein PNM1, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60960`	RNA-binding protein that functions in both mitochondrion and nucleus.	An Arabidopsis dual-localized pentatricopeptide repeat protein interacts with nuclear proteins involved in gene expression regulation.2011 · DOI: 10.1105/tpc.110.081638

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030572 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006417 regulation of translation Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010239 chloroplast mRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G20300

ath:AT3G53700

ath:AT5G60960

ath:AT5G61370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.812

Rank 1 · TkA07G411920 · TK1151

Nucleus0.107

Rank 2 · TkA07G411920 · TK1151

Plastid0.051

Rank 3 · TkA07G411920 · TK1151

Cytoplasm0.026

Rank 4 · TkA07G411920 · TK1151

Cell membrane0.010

Rank 5 · TkA07G411920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_219-58 aa

PF01535PPR21-43 aa

PF12854PPR_122-39 aa

PF13812PPR_329-56 aa

PF12854PPR_141-72 aa

PF13041PPR_249-78 aa

PF01535PPR49-78 aa

PF13812PPR_369-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G411920	`PF13041`	PPR_2	19	58	1.3e-11	45.1
TkA07G411920	`PF01535`	PPR	21	43	2.5e-07	31.2
TkA07G411920	`PF12854`	PPR_1	22	39	2.1e-06	28.1
TkA07G411920	`PF13812`	PPR_3	29	56	3.2e-06	27.8
TkA07G411920	`PF12854`	PPR_1	41	72	2.1e-06	28.1
TkA07G411920	`PF13041`	PPR_2	49	78	1.3e-11	45.1
TkA07G411920	`PF01535`	PPR	49	78	2.5e-07	31.2
TkA07G411920	`PF13812`	PPR_3	69	78	3.2e-06	27.8
TkA07G411920	`PF16205`	Ribosomal_S17_N	91	136	0.12	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FME4`	Arabidopsis thaliana	sp\|Q9FME4\|PP438_ARATH Small ribosomal subunit protein mL104 (rPPR9)	60.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card