TkA07G411910 | RubberDandelionOmics

Gene overview

TkA07G411910

Reference: TK1151 Chr: Chr07 Coordinates: 104071998-104076571 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1980 bp · TkA07G411910|TK1151|cDNA

GAACACACGTGTCAACACTATAACTATTTTCAATTTTCTTTTTCCACCTATTTAACATTTTCTATAGTTGCTTTTTGAGACCATATTTGACATTTTGTCTAAATAACAATCAAAACTTTGAGCTACTTACTTGTTGACCAAAGATAGATGTTCACAGAGGGCCTCGTCTACCACTGTTGCAAAGTGAGTGGCATCAGCCATGGCCAAATCGAAAGCAACACAGATTTTAAGCACAAAATACTCGAACCCATCTGAAATCA...

CDS

Download CDS FASTA

1320 bp · TkA07G411910|TK1151|CDS

ATGGATAACAACAACAACTTGGAGCAGACATTGCAGGAAGGAAAGCTTTACCGATACGTGAACAATTTAATTGTTGCTCATCTTCGAGACAACAATCTCACCCAGGCTGCAAGTGCAGTTGCATCAGCTACAATGACACCACTCAACATTGAAGCTTCTCCCAACAAACTTCTCGAACTAGTTGCCAAGGGTCTTGCAGTTGAAAAAGATGAAACCCTAAGAGGAGTACTCTCATCAACATTGTTTGATTCAAACACAGT...

Protein

Download Protein FASTA

439 aa · TkA07G411910|TK1151|PROTEIN

MDNNNNLEQTLQEGKLYRYVNNLIVAHLRDNNLTQAASAVASATMTPLNIEASPNKLLELVAKGLAVEKDETLRGVLSSTLFDSNTVLPSSYGLIPPPRAVSVDFSAAHDTKGSSKSFPKHETRHVSEHKNVARCARFSPDGRFLASGSADTSIKLFEVGKIKQMLLPEGRDGPVRPVVRTFYDHLQPINDLDFHPHNTILISGAKDHTIKFFDFSKTVAKRAFRVIQDTHNVRSVSFHPSGDFVLAGTDHHVPHLYDIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA07G411910`
TK1151 ID	TkA07G411910
OH-1004 ID	LXL04_030571
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA07G411910

Location Chr07:104071998-104076571 (+)

Description Similar to CSTF50: Cleavage stimulation factor subunit 50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60940`	One of the multiple factors required for polyadenylation and 3'-end cleavage of pre-mRNAs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030571 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031124 mRNA 3'-end processing Biological Process

GO:0031440 regulation of mRNA 3'-end processing Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005848 mRNA cleavage stimulating factor complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G60940

hsa:1477

mmu:67337

pon:100174553

rno:311670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.529

Rank 1 · TkA07G411910 · TK1151

Cytoplasm0.459

Rank 2 · TkA07G411910 · TK1151

Lysosome / Vacuole0.076

Rank 3 · TkA07G411910 · TK1151

Cell membrane0.064

Rank 4 · TkA07G411910 · TK1151

Golgi apparatus0.037

Rank 5 · TkA07G411910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29040LisH_CTF506-75 aa

PF25172Beta-prop_WDR3_2nd105-304 aa

PF23609Beta-prop_EIPR1109-157 aa

PF29037DSE1_N109-242 aa

PF30552CFAP251_N115-238 aa

PF24782WD40_MABP1-WDR62_2nd117-173 aa

PF24796WDR55120-161 aa

PF24807WD40_CDC20-Fz121-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA07G411910	`PF29040`	LisH_CTF50	6	75	8.3e-40	135.3
TkA07G411910	`PF25172`	Beta-prop_WDR3_2nd	105	304	2.8e-28	99.7
TkA07G411910	`PF23609`	Beta-prop_EIPR1	109	157	1.7e-09	38.3
TkA07G411910	`PF29037`	DSE1_N	109	242	7.4e-06	26.0
TkA07G411910	`PF30552`	CFAP251_N	115	238	2.1e-06	27.9
TkA07G411910	`PF24782`	WD40_MABP1-WDR62_2nd	117	173	3.7e-15	56.4
TkA07G411910	`PF24796`	WDR55	120	161	4.6e-24	85.7
TkA07G411910	`PF24807`	WD40_CDC20-Fz	121	217	4.4e-26	92.6
TkA07G411910	`PF23393`	Beta-prop_WDR90_POC16_2nd	121	164	1.9e-08	34.6
TkA07G411910	`PF25174`	Beta-prop_THOC3	122	176	1.7e-39	136.2
TkA07G411910	`PF23414`	Beta-prop_EML_2	123	161	5.4e-25	89.0
TkA07G411910	`PF25168`	Beta-prop_WDR36-Utp21_2nd	123	161	3.1e-23	83.3
TkA07G411910	`PF25391`	WD40_Gbeta	123	289	3.6e-17	63.1
TkA07G411910	`PF23419`	WD40_RFWD3	123	159	8.1e-07	29.4
TkA07G411910	`PF23775`	Beta-prop_RIG_2nd	123	162	3e-05	24.3
TkA07G411910	`PF00400`	WD40	124	157	3.9e-38	129.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L4J2`	Arabidopsis thaliana	sp\|Q8L4J2\|CTF50_ARATH Cleavage stimulation factor subunit 50	64.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card